SKU: 65578841527

LL-37

Sale price$58.50 Regular price$65.00
Save 10%

Pay in installments of $16.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LL-37LL 37: Pioneering Antimicrobial Peptide for Research Advance Your Immunology Studies with LL 37 LL 37, a cathelicidin derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies. LL 37 Specifications: Sequence: [LL-37, 37 aa] Molecular Weight: 4493. 33 g mol

LL-37: Pioneering Antimicrobial Peptide for Research

Advance Your Immunology Studies with LL-37

LL-37, a cathelicidin-derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies.

LL-37 Specifications:

  • Sequence: [LL-37, 37 aa]
  • Molecular Weight: 4493.33 g/mol
  • Purity: >95%
  • Available in 10mg vials

Research Applications:

  • Antimicrobial mechanism studies
  • Innate immunity investigations
  • Wound healing research
  • Anti-biofilm activity analysis

Why Source LL-37 From Us?

  • Rigorous quality control ensures consistent purity
  • Comprehensive documentation, including certificates of analysis
  • Competitive pricing for research budgets
  • Prompt, discreet shipping to research facilities worldwide

Expand Your Research Horizons

Incorporate LL-37 into your studies to explore its diverse biological activities. Whether you’re investigating antimicrobial resistance, wound healing processes, or immune modulation, LL-37 offers a versatile tool for cutting-edge research. To buy LL-37 10mg or inquire about bulk orders, please contact our dedicated research support team. We’re committed to supporting your groundbreaking work in immunology and microbiology. Important: LL-37 is intended for research use only. Not for diagnostic, therapeutic, or human use. Elevate your antimicrobial peptide research – purchase LL-37 through our trusted platform today.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65578841527

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
RW
Birmingham, US
★★★★★ 5
Good Quality and Easy to Install and
Model: iPad A16 11th 2025 /10th 2022
This glass protector was the easiest one i have ever used. went in on easily and only a couple of bubbles that were easy to push out. It seems to be made with quality material and fits perfectly. Got the first one right so now i have a spare.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
M
Verified Purchase
M. Inglee
Grantham, US
★★★★★ 5
Very nice case
Model: iPad A16 11th 2025 /10th 2022
Fits well. Very sturdy. Looks great and was easy enough for a 9 year old to install ;-)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
A
Verified Purchase
AD Burrows
Bozeman, US
★★★★★ 5
The perfect screen protector.
Model: iPad A16 11th 2025 /10th 2022
What a great product! I’ve used this brand in the past for my iPhone & and iPads, always found them easy to install & the crystal clear HD quality is amazing. It’s easy to align & comes with two just in case you mess up otherwise you have a spare as a backup. Worth every penny.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
R
Verified Purchase
rebecca
Pawtucket, US
★★★★★ 5
Glass screen cut shield
Model: iPad A16 11th 2025 /10th 2022
This is a great product. I’ve used on every phone I’ve owned and now I’m using it on my tablets. Wouldn’t use anything else. Love it. Price is great and the product works great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
T
Verified Purchase
T'Quanda
Alexandria, US
★★★★★ 4
Clear protection with easy installation
Model: iPad 9th/8th/7th Gen 10.2 Inch, Model: iPad 9th/8th/7th Gen 10.2 Inch
The ProCase screen protectors fit my iPad 7th generation well and provide clear protection without affecting touch sensitivity or screen clarity. The installation process was very simple, Unfortunately I did have some trouble with bubbles forming in the corner after applying the first one, which was a bit difficult to fully smooth out. The second protector went on slightly better, but it still required extra effort to get a perfect finish. Despite that issue, the screen protector still does its job well in protecting against scratches and daily wear. It also comes in a 2 pack, which adds good value in case one is applied incorrectly. It’s a solid product for protection, but the installation can be a little tricky if you want a completely flawless, bubble free look
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026

recommand products