Pay in installments of $80.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP7 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 7 Accession O15540 Amino Acid Sequence Val2 Ala132, with N terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance
Product Specification
| Species | Human |
| Synonyms | Fatty acid binding protein 7 |
| Accession | O15540 |
| Amino Acid Sequence | Val2-Ala132, with N-terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
| Expression System | E.coli |
| Molecular Weight | 16kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Fatty acid binding protein 7 (FABP7, alternative names brain FABP (B-FABP), brain lipid-binding protein (BLBP) and mammary derived growth inhibitor-related gene (MRG)). Compared to normal brain tissue and low-grade astrocytomas, FABP7 is up-regulated in glioblastoma, and increased nuclear localization of FABP7 in glioblastoma is associated with EGFR amplification and poorer outcomes. The expression of FABP7 is also linked to enhanced cell motility and migration, with a decreasing docosahexaenoic acid (DHA, [ω-3])-arachidonic acid (AA, [ω-6]) ratio appearing to govern these effects, perturbing the normal, tightly regulated ratio of fatty acids in brain tissue and providing increased substrate for prostaglandins such as PGE2 to promote progression.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 23 reviews
Sort
Product Reviews
★★★★★ 5
Nearly instant blending
Color: P-Storage Cover Black, Size: Prestige Rechargeable
Wow! That's my impression of this handy gadget. It has a quality feel to it and super easy to understand. I charged it up full and have used it more than a dozen times with no sign of it needing a recharge. My main use is to blend my protein powder into milk and juice in the morning. Let me tell you - it takes about five seconds. Instead of fighting the blend with a spoon for nearly a minute this frother has it done so quickly it's amazing. The powder and fluids are mixed WAY better than with a spoon and in record time.
It also makes the drink much smoother and the taste is thick and creamy. It's hard to describe how easily it functions. Oh and clean up? That's a snap. Just dunk it in clear water and turn it on a few seconds. This is one of the handiest tools I've ever added to my kitchen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
★★★★★ 4
Powerful
Color: P-Storage Cover Black, Size: Prestige Rechargeable
The only reason I gave this a 4 star is that I wish it had a slower speed. Have to be careful not to fling liquid everywhere with a smaller cup. It does have power!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
★★★★★ 5
Like this tem a lot. Fast to charge, no batteries needed. 2 speeeds and works great.
Color: P-Stand & Storage Cover Black, Size: Prestige Rechargeable
Really like this iitem. No batteries because its rechargeble. It has 2 speeds and is really fast. So much more power than my old battery one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
★★★★★ 5
Good product
Color: P-Storage Cover Black, Size: Prestige Rechargeable
Works as it should. Easy to clean and charges quickly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
★★★★★ 5
Great Little Gadget
Color: C-Black, Size: Model C Rechargeable
What a fun and easy to use gadget! I use it to foam Zero Sugar Coffeemate creamer for my iced coffee and it works perfectly. I thought the on/off button was on the top but it's on the side. I was concerned that I would unintentionally bump it but I don't. Easy to use, easy to clean and price is reasonable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026