SKU: 12997990640

Human FABP7, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FABP7, His tagProduct Specification Species Human Synonyms Brain lipid binding protein (BLBP), Brain type fatty acid binding protein (B FABP), Fatty acid binding protein 7, Mammary derived growth inhibitor related, BLBP, FABPB, MRG Accession O15540 Amino Acid Sequence Protein sequence (O15540, Val2 Ala132, with C 10*His) VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKAGGGGSHHHHHHHHHH

Product Specification


Species Human
Synonyms Brain lipid-binding protein (BLBP), Brain-type fatty acid-binding protein (B-FABP), Fatty acid-binding protein 7, Mammary-derived growth inhibitor related, BLBP, FABPB, MRG
Accession O15540
Amino Acid Sequence

Protein sequence (O15540, Val2-Ala132, with C-10*His) VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKAGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 16.6 kDa Observed MW: 16.6 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 7, brain (FABP7) is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. FABP7 is expressed, during development, in radial glia by the activation of Notch receptors. Reelin was shown to induce FABP7 expression in neural progenitor cells via Notch-1 activation. According to one study, FABP7 binds DHA with the highest affinity among all of the FABPs.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 12997990640

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kayci Frederick
Phoenix, US
★★★★★ 5
Great vegan D3 with K2 combination
Size: 60 Count (Pack of 1)
Finally found something that combines vegan D3 with K2 in an organic form. The 5000IU dosage is potent and seems effective for bone support. I appreciate that it's plant-based and has high absorption, which feels like a quality supplement. The packaging is convenient, making it easy to take daily. Overall, a reliable product for maintaining bone health.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 18, 2025
A
Verified Purchase
Anna
Draper, US
★★★★★ 5
Good
Size: 60 Count (Pack of 1)
Great Supplement for Bone and Immune Health! I’ve been taking NatureWise Vitamin D3 + K2 for a few months now, and I can really feel the difference. I chose this brand because it combines D3 and K2 — a perfect pair for supporting calcium absorption and overall bone health. The softgels are small, easy to swallow, and don’t have any aftertaste. I also appreciate that they use non-GMO ingredients and cold-pressed olive oil as the carrier, which helps with absorption.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2025
S
Verified Purchase
S. A. Coppens
Los Angeles, US
★★★★★ 5
Returning Customer
Size: 60 Count (Pack of 1)
I think this is a really good buy. Good quality. Vitamins are costly. Happy with these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
S
Verified Purchase
Sonya Gable-Wilson
Boise, US
★★★★★ 5
This D3 works really well
Size: 60 Count (Pack of 1)
The NatureWise Vegan Vitamin D3 + K2 supplement combines premium ingredients and supports my immune system effectively. I appreciate the organic cold-pressed olive oil used for high absorption. The capsules are easy to swallow, and I feel confident about the non-GMO quality. It's become a reliable part of my daily health routine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 20, 2025
A
Verified Purchase
Amazon Customer
Bozeman, US
★★★★★ 4
Vitamins
Size: 60 Count (Pack of 1)
Does the job, no taste easy to swallow
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 17, 2025

recommand products