SKU: 13075763859

GITR/TNFRSF18 Fc Chimera Protein, Human

Sale price$250.65 Regular price$278.50
Save 10%

Pay in installments of $69.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GITR/TNFRSF18 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CD357 antigen, CD357, GITR, GITR D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid induced TNFR related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18 Accession Q9Y5U5 1 Amino Acid Sequence Gln26 Glu161, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms CD357 antigen, CD357, GITR, GITR-D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid-induced TNFR-related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18
Accession Q9Y5U5-1
Amino Acid Sequence

Gln26-Glu161, with C-terminal Human IgG Fc QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 40-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1,Nature Communications volume 12, Article number: 1378 (2021) Cite this article  5809 Accesses  9 Citations  1 Altmetric  Metrics.

Background

GITR(Glucocorticoid-induced Tumor necrosis factor Receptor), also known as AITR and TNFRSF18, is a 40 kDa transmembrane glycoprotein belonging to the tumor necrosis factor receptor (TNF-R) superfamily. Mature human GITR consists of a 137 amino acid (aa) extracellular domain (ECD) with three tandem TNFR cysteine-rich repeats, a 21 aa transmembrane segment, and a 58 aa cytoplasmic domain. GITR is expressed on CD4+CD25+ regulatory T cells (Treg) as well as on subsets of thymocytes, lymph node cells, and splenocytes. GITR plays a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13075763859

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Eva Hansen
Grantham, US
★★★★★ 5
Great for adults who need full liquid diets!
Flavor Name: Turkey Bolognese with Bone Broth, Size: 3.5 Ounce (Pack of 1)
I don't really write very many reviews, but I am an adult with gastroparesis and these pouches are amazing!! I've been dealing with GP for over 15 years and I wish I'd known about these sooner. When I am in a bad flare, sometimes all I can keep down is liquids and baby food. These are so gentle on my stomach, and leave me feeling truly nourished, unlike so many of the mainstream baby foods that are clearly low quality meat or very sugar laden. I try to make my own soups and liquids from a Paleo mindset, but sometimes when you're really sick, you don't have the energy to even put something in the blender. These are amazing for those times and will be a staple in my arsenal from now on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2025
C
Verified Purchase
Clmx4
Cuba, US
★★★★★ 5
My daughter goes crazy for these!
Flavor Name: Turkey Bolognese with Bone Broth, Size: 3.5 Ounce (Pack of 6), Flavor Name: Turkey Bolognese with Bone Broth, Size: 3.5 Ounce (Pack of 6)
I was really nervous about introducing meat to my daughter, but Serenity Kids pouches made it really easy! She loves the turkey bolognese one, and I love that it's pasture-raised with organic ingredients! My 8 & 6 year old gave them a try and said they were super yummy! Highly recommend!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 2, 2021
J
Verified Purchase
Jim K.
Dallas, US
★★★★★ 5
Not just for kids. A great snack for long drives.
Flavor Name: Turkey Bolognese with Bone Broth, Size: 3.5 Ounce (Pack of 12)
Our daughter buys these for her toddler (1-1/2 years old). I do a lot of long distance driving and thought that these would be a convenient way to have a snack or even a small meal. I have just spent six days behind the wheel on a road trip and they worked out great! A good mixture of protein (beef, turkey, chicken) and veggies, especially the combinations. They are easy and safe to use while driving, have good flavor, are more filling than I thought they would be, and are certainly healthier than the snacks that are usually available on the road.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 20, 2022
M
Verified Purchase
Mich912
Natrona Heights, US
★★★★★ 5
One Satisfied Mom and Baby
Flavor Name: Turkey Bolognese with Bone Broth, Size: 3.5 Ounce (Pack of 12)
Early on when on the hunt for baby food, this was one of the few brands where not only can I pronounce all of its organic ingredients, but the proteins were all pasture raised, wild caught and grass fed. So the true test was the taste test, SHE LOVED IT! Ate the whole thing in a matter of minutes. I use these when I’m out or on the run and I love it because I know she’s getting adequate nutrition with the best ingredients.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 30, 2020
H
Verified Purchase
Hey, its Lynsey!
San Leandro, US
★★★★★ 4
Hear Me Out!
Flavor Name: Turkey Bolognese with Bone Broth, Size: 3.5 Ounce (Pack of 6)
Okay, all moms, you've got to hear me out on this one! The first time my kiddo tried this he hated the flavor! I mentioned it in my IG stories and the company themselves sent me tips and tricks on how to serve these meats. The problem was, my baby had never had baby meat before, just fruits and veggies. Please understand that the thickness is a little thicker, but still creamy enough for even new eaters. We tried different recipes and ideas and now my son love them and gets his proteins. I am SUPER impressed with this company and their willingness to help and offer advice and ideas. Their products are HIGH quality and made of only the best ingredients which makes this mama very happy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2021

recommand products