Pay in installments of $31.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 17 - Aug 22
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human IL-8, His TagProduct Specification Species Human Accession P10145 Amino Acid Sequence SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 10. 1 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4 Reconstitution Reconstitute at less than 1 mg mL according to the size in deionized water
Product Specification
| Species | Human |
| Accession | P10145 |
| Amino Acid Sequence | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH. |
| Expression System | HEK293 |
| Molecular Weight | 10.1 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 0.2M PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Background
IL-8, also known as chemokine CXCL8, is a cytokine secreted by macrophages and epithelial cells. IL-8 binds to interleukin-8 receptor α(IL8RA, also called CXCR1) and interleukin-8 receptor β(IL8RB, also known as CXCR2), resulting in cytochemotaxis neutrophils to regulate inflammatory responses. IL-8 also has a strong pro-angiogenesis effect.IL-8 is almost undetectable under physiological conditions, but under inflammatory conditions, IL-8 levels are rapidly increased by TNF-α, IL-1β and other effects. IL-8 binds to CXCR1 and CXCR2 to promote tumor growth, progression, metastasis and drug resistance through a series of mechanisms. IL-8 plays an important role in the pathogenesis of bronchitis and cystic fibrosis. This product is the recombinant human IL-8 protein expressed from human 293 cells (HEK293).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy