SKU: 13699771146

Biotinylated BCMA Fc&Avi Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated BCMA Fc&Avi Tag Protein, HumanProduct Specification Species Human Antigen BCMA Synonyms TNFRSF17, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Met1 Ala54, with C terminal Human IgG1 Fc &Avi tag

Product Specification


Species Human
Antigen BCMA
Synonyms TNFRSF17, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal Human IgG1 Fc &Avi tag

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE


Expression System HEK293
Molecular Weight

38-45kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Nina Shah, Ajai Chari, Emma Scott, Khalid Mezzi& Saad Z. Usmani: B-cell maturation antigen (BCMA) in multiple myeloma:rationale for targeting and current therapeutic approaches, Leukemia volume 34, pages985–1005 (2020).


Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13699771146

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jonathan Davies
Omaha, US
★★★★★ 5
Matte, weightless, mildly drying
Size: 3 Fl Oz (Pack of 1), Style: SPF 50, Size: 3 Fl Oz (Pack of 1), Style: SPF 50
Very good sunscreen. It is very similar to the Neutrogena Ultra Sheer sunscreen but with less/minimal fragrance. It absorbs immediately and feels matte and invisible. The only slight downside is that the silica in the sunscreen is actually so good at absorbing oil that it is mildly drying. This is great for people with oily skin, but people with acne like myself often use retinoids that are already very drying, and this can magnify the dryness. I often follow this sunscreen with some moisturizer to counteract the drying effect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
O
Verified Purchase
Ofelia Ruiz
Lexington, US
★★★★★ 5
No white cast.
Size: 3 Fl Oz (Pack of 1), Style: SPF 50
Doesn't leave a white cast on your face as long as you rub it in enough. It also doesn't break me out. Good product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
J
Verified Purchase
Jeremy B.
Belleville, US
★★★★★ 5
Great - effective sunscreen that isn't oily
Size: 3 Fl Oz (Pack of 1), Style: SPF 50
Works well, doesn't make your skin oily, almost disappears when you put it on. Made for faces but of course works anywhere else as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
F
Verified Purchase
Frank aguirre
Pawtucket, US
★★★★★ 4
It is a good sunscreen, but if your skin is very oily, think again.
Size: 3 Fl Oz (Pack of 1), Style: SPF 50
I have tried many, MANY sunscreens, and this one is in my top 10, but not at the very top. Why not? Well, what I like about it is that you get a good amount for an excellent price. It's lightweight, but not extremely so, and this size can easily last you 3 months without any problem. However, while it's made for oily skin, it's not that light. After just a few hours of application, it can leave your skin feeling greasy, especially if you sweat easily. It doesn't leave a white cast, but it does leave a slight, shiny finish. Reapplying isn't very comfortable. If you use it just once a day, it's fine, but if you apply it more often, your skin will feel a bit heavy and oily. I think this sunscreen is better for specific occasions rather than for daily use. If I had to choose a sunscreen for daily use, I would pick one with a lighter formula, like Fusion Water from Isdin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 11, 2025
T
Verified Purchase
Tashelle Anderson
Bozeman, US
★★★★★ 5
Very good sunscreen
Size: 3 Fl Oz (Pack of 1), Style: SPF 50
I love this, it’s very light weight, no white cast and not very oily. Love it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026

recommand products