SKU: 14011263247

LILRB2/CD85d/ILT4 His Tag Protein, Cynomolgus

Sale price$207.00 Regular price$230.00
Save 10%

Pay in installments of $57.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB2/CD85d/ILT4 His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Accession BAE87348. 1 Amino Acid Sequence Gly24 Leu448, with C terminal 8*His

Product Specification


Species Cynomolgus
Accession BAE87348.1
Amino Acid Sequence Gly24-Leu448, with C-terminal 8*His GTLPKPMLWAEPGSMISEGSPVTLRCQGSLQVQEYRLYKGKKPASWVRRIQQELVKKGYFAIGFITWEHTGQYRCQYYSHSWWSEPSDPLELVVTGAYSKPTLSALPSPVVASGGNVSLQCDSQVTFDGFVLCKEGEDEHPQRLNSQSHARGWSWAVFSVVPVSPSRRWSYRCYGYDSHSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCGSDVGYDRFALYKEGERDFLQRPSRQPQAGLSQANFLLGPVSRSHGGQYRCSGAHNLSSEWSAPSDPLDILISGQIRGTPFLSVQPGPTVVSGENVTLLCQSSWQFHAFLLTQAGAADAHLHLRSMYKYPKYQAELSMSPVTSAHAGTYRCYGSLSSNPYLLSVPSDPLELVVSGAVDTLGLSQNNSETKTASHSQDYTVENLGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 63-70kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B2 (LILRB2) is a member of leukocyte Ig-like receptors (LILRs), also known as CD85D, ILT4, LIR2, and MIR10, contains four extracellular immunoglobulin domains, a transmembrane domain, and three cytoplasmic ITIMs. It is expressed on hematopoietic stem cells, monocytes, macrophages, DCs, neutrophils, basophils, platelets, and activated CD4+T cells, as well as in vitro cultured endothelial cells, mast cell progenitors, and osteoclasts. LILRB2 plays physiological roles in multiple tissues. LILRB2 is involved in immunotolerance in pregnancy and transplantation. HLA-G/LILRB2 interactions promote accumulation and the suppressive activity of MDSCs during human pregnancies. Crosslinking of LILRB2 with Fcγ R in vitro led to inhibition of Fcγ R-mediated signaling in monocytes and serotonin release in basophilic cells. Upregulation of LILRB2 induced the tolerance of DCs. Interaction of LILRB2 with HLA class I molecules is positively associated with viral replication in HIV, suggesting that this interaction leads to a blunted immune response. Upregulation of LILRB2 and LILRB4 in antigen-presenting cells in response to Salmonella infection suggests a role for these receptors in balancing the inflammatory response against bacterial infection. LILRB2 is localized in neutrophil lipid rafts and rapidly moves to the cell surface upon neutrophil stimulation. This upregulated LILRB2 then enhances the inhibitory signals of HLAG on the phagocytic function of neutrophils. Future studies are required to shed light on how neutrophil and immune responses are modulated through LILRB2 interactions with this diverse set of ligands.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 14011263247

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
Ileana
Alexandria, US
★★★★★ 5
Recomendados
Excelente combo, son mis protectores preferidos.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
E
Verified Purchase
Erica
San Leandro, US
★★★★★ 5
Affordable
Good price and didn’t bother my sensitive skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2026
C
Verified Purchase
Caroline
Draper, US
★★★★★ 5
Lightweight tinted SPF that looks beautiful on mature skin
I’ve tried a lot of tinted sunscreens, and this one is honestly one of the nicest I’ve used for everyday wear. The Eucerin Tinted Age Defense SPF 50 feels lightweight, blends easily, and gives the skin a healthy natural glow without looking heavy or greasy. The texture is smooth and hydrating, and I was pleasantly surprised by how well the tint adapted to my skin tone. It helped even out my complexion while still looking very natural. On mature skin, that is important because many tinted SPFs can settle into fine lines or look dry after a few hours. This one stayed comfortable and looked fresh throughout the day. I also liked that it layered well over skincare and under makeup without pilling. The finish is more radiant than matte, which gives the skin a healthier and less tired appearance. The addition of hyaluronic acid is a nice bonus because the product feels more moisturizing than many sunscreens I’ve tested. The packaging is practical, easy to use, and perfect for daily use or travel. SPF 50 protection combined with skincare benefits makes this a great all in one daytime product. The tint may not work perfectly for every skin tone since it is designed as a universal shade, but on my skin it blended much better than expected. If you’re hesitating between Eucerin and CeraVe, this one is better for mature skin, a more elegant finish, and higher sun protection since this version offers SPF 50 while many tinted CeraVe options only go up to SPF 30. If you specifically want higher daily protection with a natural radiant finish, this one is definitely the better choice for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
A
Verified Purchase
Anonymous
San Leandro, US
★★★★★ 5
Eucerin sunscreen spf 50
The best sunscreen I’ve ever had. No white cast, no clogging pores. Goes on smooth and silky. No flaking off. Absolutely love it. I’m a dark skinned black woman for reference
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
C
Verified Purchase
Chrissy
Massapequa, US
★★★★★ 5
Eucerin for the Win...Again!
I love this tinted sunscreen. It's so lightweight and blends in really well. Since it blends in, it is good for all shades of skin. It doesn't have a strong smell like a lot of other sunscreens have, so that is a huge bonus. So far I'm really loving it. I am definitely a Eucerin girly. I love all things Eucerin at this point.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026

recommand products