SKU: 14465465444

Mouse IgG lambda1, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IgG lambda1, His tagProduct Specification Species Mouse Accession P01843 Amino Acid Sequence Protein sequence (P01843, Gln1 Ser105, with C 10*His) QPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRADCSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 3 kDa Observed MW: 15 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Mouse
Accession P01843
Amino Acid Sequence

Protein sequence (P01843, Gln1-Ser105, with C-10*His) QPKSSPSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLSRADCSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.3 kDa Observed MW: 15 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. Representing approximately 75% of serum antibodies in humans, IgG is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Lambda light chains are one of the two classes of light chains present on mammalian immunoglobulins. They are found in combination with kappa light chains. These chains are usually present in a 70:30 ratio of kappa to lambda. Anti-lambda light chain antibodies can nonspecifically bind to multiple isotypes of immunoglobulins.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 14465465444

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sassyondra
Natrona Heights, US
★★★★★ 5
Love it.
Color: Rainy-Rainbow
This glitter is gorgeous on. Really easy to apply, sprays evenly and a good amount at once. It wasn’t a nightmare to deal with either clinging to things it fell/rubbed onto which I was pleasantly surprised by. It cleans up very well. A little goes a long way too, so it should last a while. It stayed on my body fairly well throughout the night too. I have really sensitive skin so I was hesitant to even get glitter at all. I tried body glitter 2 years ago but it was a liquid spray kind and I broke out in an intense rash all over. I also have a chronic hive condition so my skin flares up from products due to sensitivity. I did not have ANY issues with this glitter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2025
J
Verified Purchase
Judith G.
Boise, US
★★★★★ 5
Absolutely Stunning Glitter with Thoughtful Packaging! | Rainy Rainbow
Color: Rainy-Rainbow, Color: Rainy-Rainbow
This glitter is breathtaking! The sparkles catch the light very beautifully — it has a mesmerizing, holographic shine that’s perfect for adding extra pizzazz to any project. When it arrived, I was pleasantly surprised at how well it was packaged. The box was securely sealed, and everything inside was perfectly intact—minor spills, no mess. A heads up on opening the entire thing: the round container’s Lid is screwed on VERY LOOSELY. Be mindful when you’re unboxing. Screw it back on very tightly. The spray nozzle on this bottle gives such a beautiful, antique perfume vibe—it really elevates the whole experience. It sprays the glitter perfectly, so it’s easy to get a flawless application every time. (Don’t forget to keep the little nozzle cover to protect it!) Honestly, I wouldn’t apply it any other way than with the bottle—it just makes everything so much smoother. 🤷🏻‍♀️ If you happen to go overboard, just grab the closest shirt and wipe off any excess. No point in wasting any of this stuff! :) Oh, & those two little gloss bottles are actually glue, which is perfect for keeping everything right where you need it to be. Here’s a little pro tip: I used the same tape that kept the box sealed to reseal the lid of the round glitter container until I’m ready to use it. Worked like a charm! 😎 It’s a small detail, but it will keep everything neat, and prevent unwanted glitter explosions in the future. If you’re a sparkle lover, you’ll adore this glitter—it’s as pretty in person as it looks online!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2024
G
Verified Purchase
Gislaine Cavassini
Phoenix, US
★★★★★ 5
incredible
Color: #03 Champagne
Simply wonderful! The fragrance is delicate and sophisticated, leaving the skin gently scented all day long. The glitter has an elegant shine and is not exaggerated, perfect for parties or special events. The application is super practical, spreads easily and the fixation is great. I recommend it to those who want a touch of glamour and brightness with an incredible smell!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
J
Verified Purchase
Jenn May
Los Angeles, US
★★★★★ 5
90’s me be jealous 🥹
Color: #04 Bronze
26 years later, here I am- the sparkling unicorn of an adult the late 90’s child version of myself DREAMED of while coating ✨EVERYTHING✨ in glitter and shimmer. Only now, I have an Amazon card and the impulse control of a toddler, so I sparkle now 🤩. Am I 40 years old? Absolutely. Did my kindergarteners at school ask why I sparkle now? Absolutely. Did my mid-life crisis self lie to them, and say because I’m a magical unicorn? Absolutely. Did they believe me? ABSOLUTELY. 10/10 recommend, but only if you too want to live your best magical unicorn life! Technical notes- the smell is light and lovely. It dries without a “feel” so I forget I even have it on. The shimmer is noticeable, but not like I rolled in glitter. I’m enjoying the bronze glimmer color, but I’m sure will be back soon for more. I could easily spray more if I wanted to be more blatant with my attention seeking. I will absolutely be using this stuff from now until I’m in my grave with no shame! Fantastic all around 🤌
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2025
A
Verified Purchase
amber
Carnegie, US
★★★★★ 1
super cute until it stops working
Color: #03 Champagne
worked really great for about 10 sprays before it clogged permanently! tried to clean out the spray mechanism but it still didn’t work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026

recommand products