Pay in installments of $11.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 12 - Aug 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
ASFV p54, His tagProduct Specification Species African Swine Fever Synonyms pE183L Accession Q65194 Amino Acid Sequence Protein sequence(Q65194 Ser54 Leu183, with C 10*His) SRKKKAAAAIEEEDIQFINPYQDQQWAEVTPQPGTSKPAGATTASAGKPVTGRPATNRPATNKPVTDNPVTDRLVMATGGPAAAPAAASAHPTEPYTTVTTQNTASQTMSAIENLRQRNTYTHKDLENSLGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 15. 5kDa Actual: 20kDa Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical
Product Specification
| Species | African Swine Fever |
| Synonyms | pE183L |
| Accession | Q65194 |
| Amino Acid Sequence | Protein sequence(Q65194 Ser54-Leu183, with C-10*His) |
| Expression System | E.coli |
| Molecular Weight | Theoretical:15.5kDa Actual: 20kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, 1mM DTT, pH7.4. Normally trehalose is added as protectant before lyophilization. |
| Reconstitution | Reconstitute no more than 1mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
African swine fever (ASF) is a highly lethal hemorrhagic viral disease of swine that usually results to a mortality rate approaching 100% in domestic pigs and is classified as a notifiable disease by the World Organization for Animal Health (OIE). A number of studies have reported that p54 is one of the most important ASFV proteins and plays a key role in virus morphogenesis and viral infection. Anti-p54 sera were found to inhibit ASFV attachment to susceptible cells, suggesting its role in virus entry. Similarly, p54/E183L gene plays an essential role in virus viability and recruitment of envelop precursors to assembly sites. Most importantly, E183L gene is crucial for virus particle transporting to perinuclear factory via direct binding to light chain 8 (LC8) of the dynein. A short p54 peptide (149–161 aa) near to its C-terminus is enough to bind to dynein light chain 8 (DLC8) and act as a cargo transport for virus particle.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy