SKU: 15770891747

Human PTP1B Protein, His tag

Sale price$105.75 Regular price$117.50
Save 10%

Pay in installments of $29.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PTP1B Protein, His tagProduct Specification Species Human Synonyms Tyrosine protein phosphatase non receptor type 1, Protein tyrosine phosphatase 1B (PTP 1B), PTPN1 Accession P18031 Amino Acid Sequence Protein sequence (P18031, Met1 Asp298, with C His tag)

Product Specification


Species Human
Synonyms Tyrosine-protein phosphatase non-receptor type 1, Protein-tyrosine phosphatase 1B (PTP-1B), PTPN1
Accession P18031
Amino Acid Sequence

Protein sequence (P18031, Met1-Asp298, with C-His tag) MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED

Expression System E.coli
Molecular Weight Predicted MW: 36.4 kDa Observed MW: 35 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Protein - tyrosine phosphatase 1B (PTP1B) is a crucial enzyme belonging to the protein tyrosine phosphatase family. PTP1B is widely distributed in various tissues such as adipose, liver, muscle, and epithelial cells, mainly located in the endoplasmic reticulum of the cytoplasm. It specifically hydrolyzes the phosphate group on the phosphorylated tyrosine residue, maintaining the balance of tyrosine protein phosphorylation with protein tyrosine kinases and participating in cell signal transduction. PTP1B negatively regulates the insulin and leptin signaling pathways, and its over - expression is closely related to the occurrence of type 2 diabetes, obesity, and other diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 15770891747

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Elle Tee
Whiting, US
★★★★★ 5
Good milk frother, drink mixer
Color: Silver
I use this every day to mix my morning protein drink. Love that it's rechargeable. And it doesn't take long to recharge. Be advised that it has 3 speeds, so when you think you're turning it off, it's actually going faster and can splatter your drink. I've learned to mix on 2, then quickly push button to 3 and then off. The speeds aren't that much different, imo, so could have one speed "on', and then 'off'.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
J
Verified Purchase
jounna.zei
Los Angeles, US
★★★★★ 1
Do not buy
Color: Silver
The worst frother i've ever used. You can't even turn it off without having to go through all the different modes, meaning you will get absolutely splashed and have to clean all the little droplets of whatever you were frothing. The power is weak. The battery did last a long time, I'll give them that. 3 months ON THE DAY the frother stopped working. A very loud noise and decreased power made it unusable. I sent them an email with NO response.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
K
Verified Purchase
Katherine
Bozeman, US
★★★★★ 5
Mixes drinks well and holds a charge
Color: Silver
I bought this frother to replace a weaker frother I had been using for months. I make iced lattes with instant espresso powder, water, and milk, and this frother does a great job at mixing the powder into the water/milk. It also leaves a nice 1" or so of milk froth on the top. I love that it can be charged with a USB-C cable and doesn't require batteries like many frothers do. It's very powerful for the size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
A
Verified Purchase
Amazon shopper
Waukegan, US
★★★★★ 5
Great Little Gadget
Color: C-Black, Size: Model C Rechargeable
What a fun and easy to use gadget! I use it to foam Zero Sugar Coffeemate creamer for my iced coffee and it works perfectly. I thought the on/off button was on the top but it's on the side. I was concerned that I would unintentionally bump it but I don't. Easy to use, easy to clean and price is reasonable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
B
Verified Purchase
Billy
Charlottesville, US
★★★★★ 4
Good speed
Color: C-Black, Size: Model C Rechargeable
Love the rechargeable feature, works great as a frother, however, I have to get use to the on/off feature instead of the press to froth like the older unit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026

recommand products