SKU: 16093208175

Human ApoE2 Protein, His Tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 7 - Aug 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ApoE2 Protein, His TagProduct Specification Species Human Synonyms Apolipoprotein E, Apo E, APOE Accession P02649 Amino Acid Sequence Protein sequence (P02649, Lys19 His317(Arg176Cys), with C His Tag)

Product Specification


Species Human
Synonyms Apolipoprotein E, Apo-E, APOE
Accession P02649
Amino Acid Sequence

Protein sequence (P02649, Lys19-His317(Arg176Cys), with C-His Tag) KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Expression System HEK293
Molecular Weight Predicted MW: 35.9 kDa Observed MW: 35-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, pH8.0 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The APOE2 protein is one of three major isoforms (E2, E3, E4) of apolipoprotein E (APOE), a key lipid transport protein involved in cholesterol metabolism and neuronal repair. Encoded by the APOE gene, APOE2 differs from the most common isoform (APOE3) by a cysteine-for-arginine substitution at position 158 (Cys158Arg), altering its structure and receptor-binding affinity. While APOE2 is associated with a reduced risk of late-onset Alzheimer’s disease (AD) compared to APOE4, homozygous carriers may develop type III hyperlipoproteinemia, a lipid disorder. APOE2 exhibits weaker binding to LDL receptors, impairing clearance of triglyceride-rich lipoproteins. Its neuroprotective effects in AD may stem from enhanced amyloid-β clearance and anti-inflammatory properties.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16093208175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Debbie Swearingen
Whiting, US
★★★★★ 5
The Best for My Furry Friend
Flavor Name: Pig Ears, Size: 12 Count (Pack of 1)
As a pet owner who always seeks the best for my furry friend, I decided to try out the Scott Pet GRILLERZ Pig Ears 12CT, and I must say, they have exceeded my expectations. **Quality and Flavor:** The pig ears come in a pack of twelve, and each ear is substantial in size and weight, indicating a high-quality product. My dog was instantly attracted to the aroma and flavor. Unlike some other treats, these pig ears are roasted to perfection, ensuring a rich and savory taste that my dog can't get enough of. **Health Benefits:** One of the standout features of Scott Pet GRILLERZ Pig Ears is their natural composition. They are free from artificial preservatives, flavors, and colors, making them a healthy and safe option for my dog. Additionally, these treats help promote dental health by reducing plaque and tartar buildup as my dog chews on them. **Longevity:** These pig ears are long-lasting, providing my dog with hours of enjoyment. This is particularly beneficial for keeping him occupied and mentally stimulated, which is crucial for his overall well-being. I have found that one ear can keep my dog entertained for a significant amount of time, making it a cost-effective treat option. **Packaging:** The packaging is sturdy and resealable, ensuring the treats remain fresh between uses. This is a thoughtful touch that I appreciate, as it maintains the quality of the product over time. **Price:** Considering the quality and quantity of the pig ears, the price point is quite reasonable. It offers great value for money, especially when compared to other similar products on the market. **Conclusion:** Overall, the Scott Pet GRILLERZ Pig Ears 12CT are a fantastic choice for any dog owner looking to provide their pet with a delicious and healthy treat. The quality, flavor, and health benefits make it a top-notch product that I highly recommend. My dog loves them, and I am confident that your pet will too!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2024
H
Verified Purchase
Hardworkingmommy
Port Orchard, US
★★★★★ 5
Healthy, natural treat my dogs actually love—no mess!
Flavor Name: Pig Ears, Size: 12 Count (Pack of 1), Flavor Name: Pig Ears, Size: 12 Count (Pack of 1)
These pig ears are the perfect natural alternative to rawhide. All three of my dogs go crazy for them, and I feel good giving them a single-ingredient treat. What I used them for: Occasional chew treats for my three dogs. Pros: Single-ingredient, natural treat Dogs love the taste and texture Doesn’t stain or leave a mess despite slobber Good size for medium to large dogs Cons: Can be a bit odorous out of the bag (minor) Real experience: I’ve given these to all three dogs multiple times, and each one enjoys them equally. Unlike some rawhide or flavored chews, these don’t leave stains or get mushy—cleanup is easy, which I really appreciate. Comparison: Much healthier and cleaner than rawhide chews or flavored alternatives, but still keeps dogs occupied for a similar amount of time. Final verdict: If you want a natural, low-mess chew for dogs who love to gnaw, these pig ears are a solid choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
A
Verified Purchase
Amazon Customer
Lexington, US
★★★★★ 5
Nice Enough for the price!
Flavor Name: Pig Ears, Size: 12 Count (Pack of 1), Flavor Name: Pig Ears, Size: 12 Count (Pack of 1)
Good price, not all are big though. But, they look like nice pigs ears and we got 13 instead of 12 (Oliver is eating one as I type so it’s not include in my pic, lol). I will order another bag fr his Christmas gift to share with his dog buddies.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2025
C
Verified Purchase
Chalkey
Chelsea, US
★★★★★ 4
Yummy pigs ear
Flavor Name: Pig Ears, Size: 12 Count (Pack of 1)
These are my dogs "special" treat. These range in size from large to small ears but my dog loves them all the same. Great for heavy chewers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
S
Verified Purchase
Simchabe
Massapequa, US
★★★★★ 5
One-and-done treat for giant breeds (our 186lb foster approves)
Flavor Name: Pig Ears, Size: 12 Count (Pack of 1), Flavor Name: Pig Ears, Size: 12 Count (Pack of 1)
We foster a 186lb Saint Bernard, and finding treats that actually satisfy her without requiring half the bag has been a challenge. These pig ears? Game changer. What makes these work: - ONE ear = one satisfied dog (compared to other treats where the bag says “35 per day” and she’d still beg for more) - Keeps her busy for about 5 minutes of focused chewing - She does a little excited dance when she sees the bag—can’t even sit, just wiggles - Zero crumbs or mess because she devours every single bit, then spends the next hour sniffing around hoping another one appears - She immediately grabs it and heads to her favorite bed to settle in—doesn’t move until it’s gone The only “issue”: There’s a bit of oil/greasiness when handling them, but nothing a quick hand wash can’t fix (Mrs. Meyer’s Cucumber soap works great, just saying). Bottom line: If you have a giant breed and you’re tired of buying treats that require multiple servings or disappear in one bite, these are it. One ear, complete satisfaction, Subscribe & Save so they just show up like a present you forgot you ordered. Our girl Ellie gives them 186 pounds of approval.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 1, 2025

recommand products