SKU: 16216972906

Human SV2A Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human SV2A Protein, His TagProduct Specification Species Human Synonyms Synaptic vesicle glycoprotein 2A, KIAA0736 Accession Q7L0J3 Amino Acid Sequence Protein sequence (Q7L0J3, Try480 Thr590, with C His Tag) YASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGT Expression System HEK293 Molecular Weight Predicted MW: 14. 7 kDa Observed MW: 25 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species Human
Synonyms Synaptic vesicle glycoprotein 2A, KIAA0736
Accession Q7L0J3
Amino Acid Sequence

Protein sequence (Q7L0J3, Try480-Thr590, with C-His Tag) YASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGT

Expression System HEK293
Molecular Weight Predicted MW: 14.7 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Synaptic Vesicle Glycoprotein 2A (SV2A) is a membrane protein found in all synaptic vesicles, the organelles responsible for storing neurotransmitters in neurons. It is the ubiquitous and primary isoform of the SV2 family. SV2A plays a critical role in regulating the exocytotic release of neurotransmitters. It is essential for priming synaptic vesicles, a process that makes them ready for calcium-triggered fusion with the presynaptic membrane. It is the direct molecular target for the anti-epileptic drug levetiracetam, underscoring its therapeutic significance in modulating neuronal excitability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16216972906

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jennifer G
Fort Morgan, US
★★★★★ 3
Madison Deserved Better
Format: Kindle
Madison was a beta...except she wasn't any longer. She was a late presenting Omega. And she was struggling. She was tall and thin, not tiny and curvy. She was opinionated. She was everything an Omega was not. After suffering through her first heat, her friends took her to Ardor, a club where Omegas came to safely find Alphas. She's not expecting much but then she connects with a sexy beta. And when she meets his Alphas, they set her body on fire. Maybe, she's found her no-strings-attached heat pack. Maybe, she's found something more. I could not connect with the characters in this book, so their story never resonated with me. And there was no love story; there was sex. Grey made it clear from the beginning that he had a true love and it was his beta boy, Rian. He went so far as to reassure Rian “Say the word, I’ll never touch her again. Lucas can put the babies in her. I only need you, beta boy”. So, Madison was there for babies, no emotions needed. Nice. No, thank you. I want the Omega to be the center of their world, not an incubator. Lucas and Rian weren't any better. After her heat, they let her leave. Not one of them made her feel valued. No one gave her a reason to stay or even offered a cuddle. And the sex didn't even come across as mind-blowing. Madison deserved better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2025
O
Verified Purchase
Oregon BookWorm
Grantham, US
★★★★★ 5
No breakup, very sweet, instalove
Format: Kindle
Omegaverse and doesn't disappoint! Sweet guys, newly Omega FMC. The boyfriends are boyfriends. What's not to love? No angst, no breakup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2025
F
Verified Purchase
ForTheLOVEofBooks
Natrona Heights, US
★★★★★ 4
Pretty Darn Good
Format: Kindle
So I’ve been on a omega kick and this definitely hit the spot. Madison was frustrating at times with how she acted towards Lucas, Gray, and Rian. It was like she said towards the end, she didn’t believe she deserved nice things. It would have been nice to hear from her best friends again. They kind of were there in the beginning and the gone except for mention of text messages received from them. I feel like her friends would have been great help in encouraging Madison to go with the pack and never give Brent another chance because he was toxic. I loved Rian. His personality was awesome. His humor. His ability to make Madison comfortable whenever she was feeling overwhelmed. And the fact he fell for her and she fell for him first. They are cute together. I do feel like Lucas was the odd man out though. Like Lucas didn’t develop as much of a relationship with Madison. I would have really liked to see more development in the relationship between them. It was also the same with him and Rian. There is really no relationship displayed. Most of the relationship being displayed is between Rian and Gray. Nevertheless, I loved reading about the dynamic that came to fruition during the entirety of this story. Madison finally got her happiness. And Brent finally got punched in the face. Everyone got exactly what they deserve.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 6, 2022
E
Verified Purchase
ediebegonia
Phoenix, US
★★★★★ 3
Pack's Promise was okay but not great
Format: Kindle
Pack's Promise was okay but not great. I won't recommend it to anyone that I know. PRO: * Very likable characters * Lots of steamy scenes that are written very well * The spelling and grammar are good * The punctuation is good with the exception of using hyphens instead of commas. Lots of hyphens. Lots and lots of hyphens. CON: * Almost no interactions with any characters outside of Madison and the pack * Nearly no plot. They meet, get together for a heat, agree to make it permanent, done * Quite a few typos such as extraneous words, missing words and words out of order THINGS TO KNOW: * More steamy scenes than storytelling * A lot of MM & MMM, some MFMM during heat
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2023
L
Verified Purchase
LJM
Phoenix, US
★★★★★ 5
such a good read
Format: Kindle
Madison, Lucas, Grey and Rian were made for each other!!! First time reading from this author and I’m not disappointed!!! Absolutely love the Love in this book and couldn’t ask for a better OV!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 25, 2023

recommand products