SKU: 1643845991

ACVR2A His Tag Protein, Human

Sale price$216.00 Regular price$240.00
Save 10%

Pay in installments of $60.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ACVR2A His Tag Protein, HumanProduct Specification Species Human Antigen ACVR2A Synonyms ACVR2A, Activin receptor type IIA, ACTRIIA Accession P27037 Amino Acid Sequence Ala20 Pro134, with C terminal 8*His AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 33kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Antigen ACVR2A
Synonyms ACVR2A, Activin receptor type IIA, ACTRIIA
Accession P27037
Amino Acid Sequence

Ala20-Pro134, with C-terminal 8*His

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

25-33kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Zhou C. et al. (2018) Downregulation of Activin A Receptor Type 2A Is Associated with Metastatic Potential and Poor Prognosis of Colon Cancer. J Cancer. 9(19): 3626-3633.

Background

ACVR2A (activin A receptor type 2A) belongs to a receptor family that mediates the functions of activins, members of the transforming growth factor-beta (TGF-β) family of ligands with multiple biological functions. The TGF-β signaling pathway is involved in the regulation of cell proliferation, differentiation, migration, and apoptosis of colon cancer. The mutation rate of ACVR2A is approximately 60%, making it the most frequently mutated gene in hypermutated colon cancer. However, the expression profiles of ACVR2A and its biological function in colon cancer tumorigenesis and progression are largely unknown.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1643845991

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Corrie King
Belleville, US
★★★★★ 5
They get it done
Style: 100ct
They get it done. Don’t sting eyes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
N
Verified Purchase
Niki M
Bozeman, US
★★★★★ 1
NOT EFFECTIVE
Style: 100ct
I wish I could give this product ZERO stars but I had to click something in order to submit this review. DO NOT PURCHASE if you want effective eye makeup removed. It is literally water on some eye pads.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
M
Verified Purchase
marcia ceciliot
Boise, US
★★★★★ 5
Gentle
Style: 100ct
Best eye maker remover I have ever tried. It is gentle and easy to use. The container is sturdy and comes with a tool to grab each wipe.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
A
Verified Purchase
Amazon Customer
Dallas, US
★★★★★ 5
Doesn’t burn your face it’s gentle
Style: 100ct
Excellent product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
M
Verified Purchase
Mitch
Cuba, US
★★★★★ 5
Our German Sheppard loves these
Size: Medium
These cost a bit more than tennis balls, but they are so much nicer and longer lasting. For starters, they stay cleaner than tennis balls because they’re smooth rubber. Dirt won’t build up on them and if anything does stick, like grass or soil, it falls off once the dog slobber dries. They’re also thick, so they don’t fall apart or blow out like a normal tennis ball does in our dog’s jaws after 30 seconds. Our GS chomps on these like crazy and the only damage they’ve suffered is a crack that developed from the edge of the hole, but the crack is growing very slowly and none of these balls have totally failed yet. The balls do whistle when thrown ant high speed and that may help a dog track and locate it, but I’m not sure. Our neighbors hear the whistling too so it’s far from silent. Lastly the orange ball is easy to locate out in our yard, but the dark blue practically disappears.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2025

recommand products