
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 8 - Jul 13
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human OX40L/TNFSF4/CD252, His tagProduct Specification Species Human Synonyms Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand (OX40L), TAX transcriptionally activated glycoprotein 1, TXGP1 Accession P23510 Amino Acid Sequence Protein sequence (P23510, Gln51 Leu183, with C His tag) QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL Expression System HEK293 Molecular
Product Specification
| Species | Human |
| Synonyms | Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand (OX40L), TAX transcriptionally-activated glycoprotein 1, TXGP1 |
| Accession | P23510 |
| Amino Acid Sequence | Protein sequence (P23510, Gln51-Leu183, with C-His tag) QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 17.1 kDa Observed MW: 19-26 kDa |
| Purity | >90% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Tag | with C-His tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
OX40L is the ligand for OX40 and is stably expressed on many antigen-presenting cells such as DC2s (a subtype of dendritic cells), macrophages, and activated B lymphocytes. The ligation of OX40-OX40L is a source of survival signal for T cells and enables the development of memory T cells. Signaling through these two molecules also leads to polarization towards Th2 immune response even in an environment with low levels of IL-4 cytokine. OX40L is also present on the surface of many non-immune cells, for example, endothelial cells and smooth muscle cells. The surface expression of OX40L is induced by many pro-inflammatory mediators, such as TNF-α, e.g. produced by mast cells, IFN-γ and PGE2. Various single-nucleotide polymorphisms (SNPs) of the OX40L gene have been identified. For some of them association with systemic lupus erythematosus has been reported.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy