Human OX40L/TNFSF4/CD252, His tag
SKU: 17022308170

Human OX40L/TNFSF4/CD252, His tag

Sale price$130.50 Regular price$145.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human OX40L/TNFSF4/CD252, His tagProduct Specification Species Human Synonyms Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand (OX40L), TAX transcriptionally activated glycoprotein 1, TXGP1 Accession P23510 Amino Acid Sequence Protein sequence (P23510, Gln51 Leu183, with C His tag) QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand (OX40L), TAX transcriptionally-activated glycoprotein 1, TXGP1
Accession P23510
Amino Acid Sequence

Protein sequence (P23510, Gln51-Leu183, with C-His tag) QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Expression System HEK293
Molecular Weight Predicted MW: 17.1 kDa Observed MW: 19-26 kDa
Purity >90% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

OX40L is the ligand for OX40 and is stably expressed on many antigen-presenting cells such as DC2s (a subtype of dendritic cells), macrophages, and activated B lymphocytes. The ligation of OX40-OX40L is a source of survival signal for T cells and enables the development of memory T cells. Signaling through these two molecules also leads to polarization towards Th2 immune response even in an environment with low levels of IL-4 cytokine. OX40L is also present on the surface of many non-immune cells, for example, endothelial cells and smooth muscle cells. The surface expression of OX40L is induced by many pro-inflammatory mediators, such as TNF-α, e.g. produced by mast cells, IFN-γ and PGE2. Various single-nucleotide polymorphisms (SNPs) of the OX40L gene have been identified. For some of them association with systemic lupus erythematosus has been reported.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17022308170

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1804 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Al
Bozeman, US
★★★★★ 5
Great shirt for the price.
Material Type: Recycled Polyester, Color: Electric Blue, Size: Large
Bought this for my son. Very nice shirt for the price, it is true to size and the color is the same as the picture. Would definitely buy it again. The material is good quality. No issues whatsoever
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
S
Verified Purchase
SM
Phoenix, US
★★★★★ 5
Great purchase
Material Type: Recycled Polyester, Color: Dark Navy, Size: X-Large
Purchased several shirts, all were great quality. You never know what you’ll get when you purchase sight unseen, these are worth it. Great value, style, and comfort. Color is exactly what you see online. True to size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 25, 2025
J
Verified Purchase
Jocelyn
Battle Creek, US
★★★★★ 4
Great quality for price
Material Type: Recycled Polyester, Color: Red Stripe, Size: XX-Large
Very impressed with the shirt quality, especially for such a low price. Sizing is accurate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
S
Verified Purchase
Shawn SnoMan Thompson
Draper, US
★★★★★ 5
For work or casual wear, this polo is a great choice.
Material Type: Recycled Polyester, Color: Port Stripe, Size: X-Large
I really like this polo. I've been wearing it once a week or every other week since November. Its very comfortable and breathable. This polo feels like it should last a while. The fit is good. I typcally wear XL and this XL fits great. I've pruchased it in both burgundy and black so far. I definitely recommend this shirt. For work or casual wear, this will look good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2026
T
Verified Purchase
Tech Dad
Los Angeles, US
★★★★★ 5
Great value: These are my go-to work from home shirt
Material Type: Recycled Polyester, Color: Blue, Size: X-Large
I’ve been pleasantly surprised by these shirts and wear them weekly for Zoom calls, since I’m still working from home these days. I figured at the price point it was worth trying them out, and now I’ve bought several in different colors. They aren’t super soft, but they are comfy and look nice. I’m 6’1” ~220 pounds, and the XL slim fit still has plenty of room. I imagine the regular cut is incredibly boxy and oversized. The difference between polyester vs recycled polyester is inconsequential. I typically buy expensive golf shirts, and these definitely aren’t as nice. They are a fraction of the cost though and a great “beater” work shirt / hang out shirt. It’s nice wearing something that looks and feels decent, but if something happens to it, you can toss and it and pick up another for the cost of a chipotle burrito.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2022

recommand products