SKU: 17797849854

Human FSH alpha&FSH beta/CGA&FSHB protein, No tag&His tag

Sale price$139.50 Regular price$155.00
Save 10%

Pay in installments of $38.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FSH alpha&FSH beta/CGA&FSHB protein, No tag&His tagProduct Specification Species Human Synonyms Follicle Stimulating Hormone, Follitropin, FSH Accession P01215P01225 Amino Acid Sequence Protein sequence1 (P01215, Ala25 Ser116) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS; Protein sequence2 (P01225, Asn19 Glu129, with C His tag) NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE Expression

Product Specification


Species Human
Synonyms Follicle Stimulating Hormone, Follitropin, FSH
Accession P01215、P01225
Amino Acid Sequence

Protein sequence1 (P01215, Ala25-Ser116) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS; 

Protein sequence2 (P01225, Asn19-Glu129, with C-His tag) NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Expression System HEK293
Molecular Weight

Predicted MW: 10.2 kDa(CGA)&14.2 kDa(FSHB);Observed MW: 20-25 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag (FSHB)&No tag (CGA)
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Follicle-stimulating hormone (FSH) is a gonadotropin, a glycoprotein polypeptide hormone. FSH is synthesized and secreted by the gonadotropic cells of the anterior pituitary gland and regulates the development, growth, pubertal maturation, and reproductive processes of the body. FSH and luteinizing hormone (LH) work together in the reproductive system. FSH is a 35.5 kDa glycoprotein heterodimer, consisting of two polypeptide units, alpha and beta. The alpha subunits of the glycoproteins LH, FSH, TSH, and hCG are identical and consist of 96 amino acids, while the beta subunits vary. Both subunits are required for biological activity. FSH has a beta subunit of 111 amino acids (FSH β), which confers its specific biologic action, and is responsible for interaction with the follicle-stimulating hormone receptor. The sugar portion of the hormone is covalently bonded to asparagine, and is composed of N-acetylgalactosamine, mannose, N-acetylglucosamine, galactose, and sialic acid.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17797849854

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cyndimp
New York, US
★★★★★ 5
Our Yorkie Puppy Loves This Toy!!!
Color: Red
Warning: your pet may become completely obsessed I’ve had this toy for about a year for my Yorkshire Terrier, Gia, and it’s easily the most successful toy purchase I’ve ever made. We even had to replace the first one after she loved it a little too much (chewed the string off), and have since bought more as gifts for friends’ pets. Great toy for small dogs (too fragile for bigger dogs) and active, young cats.) What we love: * Endless engagement: Gia ignores all her other toys and goes straight for this every time * Interactive features: Subtle beeping + changing colored lights + unpredictable rolling patterns keep her hooked * Energy burner: Perfect for indoor play on hardwood floors—she will chase it nonstop * Rechargeable: Battery lasts several hours, even with frequent use * Durability: Holds up well considering how rough she plays Real-life note: Gia will literally bring this toy to me to get me involved—and I have to limit her playtime because she won’t stop on her own. Bottom line: If you have a high-energy dog (or even a playful cat), this isn’t just a toy—it becomes their favorite activity… and possibly their entire personality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
P
Verified Purchase
Paula Hurst
Belleville, US
★★★★★ 3
I wanted it to be a good fit
Color: Red
This toy garnered my dogs attention for a day. We tried it inside but there's too many places it would go under. We tried ot outside and it was powerful enough in the grass so tried concrete patio. My dog lost interest sadly. It wasn't a good product for my dog.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
R
Verified Purchase
Rossanne Wankovsky
Alexandria, US
★★★★★ 5
My pup loved it.
Color: Red
“Bought this for my dog Loki and it was an instant hit. He usually loses interest in toys pretty quickly, but this ball kept him entertained way longer than expected. The lights and movement immediately grabbed his attention, and he spent a solid hour chasing, pawing, and carrying it around the house. It’s durable enough for excited play, easy to charge/use, and even survived Loki’s dramatic ‘victory laps’ through the living room. Bonus: it tired him out enough for an actual nap afterward. Definitely worth it for high-energy dogs or curious pets.”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
D
Verified Purchase
Diajsha Candillo
West Palm Beach, US
★★★★★ 5
Great toy to occupy pet
Color: Red, Color: Red
This ball is super fast, and lasts very long on one charge. It really keeps my cat entertained, he’s just so curious about it. It’s easy to pick out dust any hair it might catch on, it’s rubber material is durable. It’s a stable toy since my cat likes to play roughly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
J
Verified Purchase
Jamie Valdez
San Leandro, US
★★★★★ 5
Great for Puppies!
Color: Red
This toy has been a great purchase for my new puppy! He has so much fun playing with it and stays engaged for long periods. While it can move a little fast at first, the adjustable speed settings make it easy to customize. Overall, it’s a fantastic toy that keeps him active, entertained, and happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 12, 2026

recommand products