Pay in installments of $31.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human E-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM 1), Leukocyte endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1 Accession P16581 Amino Acid Sequence Protein sequence (P16581, Trp22 Pro556, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM-1), Leukocyte-endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1 |
| Accession | P16581 |
| Amino Acid Sequence | Protein sequence (P16581, Trp22-Pro556, with C-10*His) WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 60.3 kDa Observed MW: 95 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
E-selectin is a selectin cell adhesion molecule expressed only on endothelial cells activated by cytokines. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. E-selectin binding to colon cancer cells correlates with increasing metastatic potential. Cancer cells of multiple tumor types bind E-selectin using glycoprotein or glycolipid ligands normally expressed on immune cells that eventually results in a tight binding between tumor cells and the activated endothelium. In addition, E-selectin may also function to recruit monocytes to primary tumors or lung metastases to promote an inflammatory pro-tumor microenvironment. E-selectin is an emerging biomarker for the metastatic potential of some cancers including colorectal cancer and recurrences. In cases of elevated blood glucose levels, such as in sepsis, E-selectin expression is higher than normal, resulting in greater microvascular permeability.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy