SKU: 18858597190

Biotinylated TNFR2/CD120b/TNFRSF1B His&Avi Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated TNFR2/CD120b/TNFRSF1B His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms TNFRSF1B, CD120b, TBPII, TNF R II, TNF R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR Accession P20333 1 Amino Acid Sequence Leu23 Asp257, with C terminal His&Avi tag

Product Specification


Species Human
Synonyms TNFRSF1B, CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR
Accession P20333-1
Amino Acid Sequence

Leu23-Asp257, with C-terminal His&Avi tag LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDGGGSGGGSHHHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

43-50kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Harald Wajant & Daniela Siegmund: TNFR1 and TNFR2 in the Control of the Life and Death Balance of Macrophages. Cell Death and Survival, Volume 7 - 2019.

Background

Tumor necrosis factor receptor superfamily 2 (TNFR-2) is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating. Tumor necrosis factor (TNF) is widely accepted as a tumor-suppressive cytokine via its ubiquitous receptor TNF receptor 1 (TNFR1). The other receptor, TNFR-2, is not only expressed on some tumor cells but also on suppressive immune cells, including regulatory T cells and myeloid-derived suppressor cells. In contrast to TNFR1, TNFR2 diverts the tumor-inhibiting TNF into a tumor-advocating factor. TNFR-2 directly promotes the proliferation of some kinds of tumor cells. Also activating immunosuppressive cells, it supports immune escape and tumor development. Hence, TNFR-2 may represent a potential target of cancer therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 18858597190

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Customer Review
Fort Morgan, US
★★★★★ 4
Comforter is nice, sheets are alright. Color is true!
Color: Burnt Orange, Size: Queen
This is a decent comforter set. The actual comforter isn’t too heavy, and would be perfect spring through fall in the Midwest. It’s a true queen size fit and the burnt orange color looks as it does in the photos. I ordered these before it mentioned they’re polyester. They definitely don’t feel as breathable as cotton sheets but as far polyester goes, they feel soft. The sheets wrinkle easily but the comforter feels durable. If you’re looking for an affordable sheet set and you’re cool with polyester, this is a good option. Also of note is that 2 of the pillow cases have a little extra fabric on the outer rim to look more “decorative.”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
V
Vmazon
Waukegan, US
★★★★★ 5
Comfortable and Attractive Bedding Set That Offers Great Value
Color: Pink, Size: Queen
This queen bedding set is a nice combination of comfort and style. The pink color looks beautiful, and the textured comforter gives the bed a cozy, modern appearance. The sheets feel soft and comfortable, while the comforter is lightweight yet provides enough warmth for a restful night’s sleep. I appreciate that the set includes everything needed for a complete bedding setup, making it a convenient option. It’s also easy to care for and holds its appearance well after washing. While it may not have the feel of a premium luxury set, for the price it’s not bad at all and offers solid value. Overall, it’s a great choice for anyone looking for an affordable and attractive bedding set.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
J
JLN
Louisville, US
★★★★★ 5
Lightweight, very smooth and comfortable comforter sheet set an a very attractive price
Color: Ivory, Size: Queen, Color: Ivory, Size: Queen
Such a well priced, attractive bed in a bag (comforter and sheet set) with the most lightweight comforter I have ever come across that is not a down comforter. This one is filled with 100% polyester with a 100% microfiber exterior. The sheets are called microfiber, which I am sometimes not a fan of as sometimes they feel too stretchy and hot. However, these feel good, and almost more like a smooth percale. It’s nice to the touch. Color is attractive in a clean ivory color. Going back to the comforter, I love the lightness of natural down, but somehow I have developed a sensitivity to the feathers which make me sneeze. This one can easily be thrown into the washer and dryer and feels equivalently light as my down comforters. It weighs in at slightly over a pound (though I could only carry it onto the scale) and I absolutely love the lightness of it. I did wash it in the washer and dried it in a dryer on normal heat. Came out with no wrinkles and very fluffy. Five stars!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
L
Lenta Bear
Carnegie, US
★★★★★ 4
Nice Comforter, Thin Sheets
Color: Blue, Size: Queen, Color: Blue, Size: Queen
I bought this comforter set for my guest bedroom, and the price was great. It’s really pretty and fits the bed perfectly. It includes a comforter, a sheet set with pillowcases, and two pillow shams. It arrived vacuum-sealed, when I opened it, I was impressed by how soft it felt—just right for a comforter. It seems like it will be warm yet cooling at the same time, and I love its thickness. The only downside was the sheet set. While the comforter is fluffy and cozy, the sheets felt cheap—very thin—and I prefer them thicker. They’re labeled 100% polyester but are just too thin for my taste. If you’re not picky about sheets, this set would be perfect. They are soft, just not thick enough. Overall, I really like the comforter, but I’ll use my own sheets because of the thinness of the included ones. I would have given it five, but the sheets bring it down to four.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
S
shantel
Los Angeles, US
★★★★★ 5
Beautiful Sage Green Set That is Super Soft and Cozy!
Color: Sage Green, Size: Queen
​I am absolutely in love with this sage green bedding set. The queen comforter has a gorgeous pre washed crinkled texture that gives the whole bedroom a really cozy, aesthetic look without needing to be ironed. It is incredibly fluffy and has just the right amount of weight to it, making it perfect to use all year round. The brushed sheets that come with the bed in a bag are surprisingly soft against the skin, and everything fit my queen mattress perfectly right out of the box. ​The color is a beautiful, calming sage green that matches my room decor perfectly. I have already washed the sheets and comforter once, and they held up great in the machine without losing their softness or shrinking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026

recommand products