SKU: 19640895560

ALK-1/ACVRL1 His Tag Protein, Mouse

Sale price$266.40 Regular price$296.00
Save 10%

Pay in installments of $74.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ALK-1/ACVRL1 His Tag Protein, MouseProduct Specification Species Mouse Synonyms SKR3, Activin receptor like kinase 1 (ALK 1), TGF B superfamily receptor type I (TSR I), Acvrl1, Acvrlk1, Alk 1 Accession Q61288 Amino Acid Sequence Asp23 Pro119, with C terminal 8*His DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 23 31kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Synonyms SKR3, Activin receptor-like kinase 1 (ALK-1), TGF-B superfamily receptor type I (TSR-I), Acvrl1, Acvrlk1, Alk-1
Accession Q61288
Amino Acid Sequence

Asp23-Pro119, with C-terminal 8*His DLAKPSKLVNCTCESPHCKRPFCQGSWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFLNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDAHLPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 23-31kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Cindy Lora Gil. Bruno Larrivée. Alk1 haploinsufficiency causes glomerular dysfunction and microalbuminuria in diabetic mice. Scientific RepoRtS (2020) 10.

Background

The Bone Morphogenetic Protein (BMP) receptor Activin receptor–like kinase 1 (Alk1), which is predominantly expressed in the vascular endothelium, has been shown to play a critical role in angiogenesis. Embryos lacking Alk1 die early during embryonic development due to impaired vascular remodeling and lack of perivascular cell coverage. In renal physiology, Alk1 has been suggested to play an important role in the regulation of extracellular matrix deposition, including collagen type I and fibronectin, and Alk1 heterozygosity has been associated with increased renal fibrosis in a mouse model of obstructive nephropathy, probably due to the decrease in the Alk1/Smad1 antifibrotic/protective signaling in renal fibroblasts.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19640895560

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
RW
Whiting, US
★★★★★ 5
Good Quality and Easy to Install and
Model: iPad A16 11th 2025 /10th 2022
This glass protector was the easiest one i have ever used. went in on easily and only a couple of bubbles that were easy to push out. It seems to be made with quality material and fits perfectly. Got the first one right so now i have a spare.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
M
Verified Purchase
M. Inglee
West Palm Beach, US
★★★★★ 5
Very nice case
Model: iPad A16 11th 2025 /10th 2022
Fits well. Very sturdy. Looks great and was easy enough for a 9 year old to install ;-)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
A
Verified Purchase
AD Burrows
Boise, US
★★★★★ 5
The perfect screen protector.
Model: iPad A16 11th 2025 /10th 2022
What a great product! I’ve used this brand in the past for my iPhone & and iPads, always found them easy to install & the crystal clear HD quality is amazing. It’s easy to align & comes with two just in case you mess up otherwise you have a spare as a backup. Worth every penny.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
L
Verified Purchase
LaQuetta Watson
Battle Creek, US
★★★★★ 5
Get it now
Model: iPad A16 11th 2025 /10th 2022
Perfect, really easy to apply as well. Looks great and fits perfectly. I also noticed there not much glare
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
T
Verified Purchase
Tania Mora
Natrona Heights, US
★★★★★ 5
Clear Protection and Easy Installation
Model: iPad 9th/8th/7th Gen 10.2-inch
I’m really happy with these screen protectors overall. The glass feels high quality and provides good protection without affecting the clarity or touch sensitivity of the iPad screen. The installation process was straightforward, and I didn’t have issues with bubbles as long as I followed the instructions carefully. Once applied, it looks clean and fits the screen well. Overall, this is a reliable and simple way to protect your iPad screen while keeping everything looking clear and responsive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products