SKU: 19672969472

Monkeypox virus A29L, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Monkeypox virus A29L, His TagProduct Specification Species MPXV Synonyms A29L, Mpox, Monkeypox Accession Q9YN60 Amino Acid Sequence Protein sequence(Q9YN60, Met1 Glu110 with C 10*His) MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 2kDa Actual: 16 23kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species MPXV
Synonyms A29L, Mpox, Monkeypox
Accession Q9YN60
Amino Acid Sequence

Protein sequence(Q9YN60, Met1-Glu110 with C-10*His)


MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 14.2kDa Actual: 16-23kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

A29L is highly homologous to Vaccinia virus envelope protein A27. A27 has multiple functions and is conserved in the Orthopoxvirus genus of the poxvirus family. A27 protein binds to cell surface heparan sulfate, provides an anchor for A26 protein packaging into mature virions, and is essential for egress of mature virus (MV) from infected cells. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19672969472

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gutale
Belleville, US
★★★★★ 5
Amazon basics mouse
Good mouse with hight quality. Works like a charm. I recommend for anyone looking for a cheap high quality Amazon basics mouse. You wont regret it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
M
Verified Purchase
Mustangjim1
Battle Creek, US
★★★★★ 5
Awesome quality mouse
Fantastic value. First it feels like a quality mouse and works like a mouse 3-4x the price. It is solid and has nice weight to it, not like some of the flimsy competitors. I am buying another just to have.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
M
Verified Purchase
M. S. Walker
Natrona Heights, US
★★★★★ 5
Great Mouse
I normally use the Logitech M325c. I've gone through dozens over the years. It works very well, but they seem to wear out fast; the wheel scroll is what fails. I decided to give the Amazon Basics a try. So far, it looks, feels, and functions the same as the Ltech; it doesn't have the fun colors, but if it holds up longer than a year, it's a fair tradeoff. I will revise this review if things change in the future, but as of now, I would recommend the Amazon Basics and will replace the other Ltech's when the time comes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
A
Verified Purchase
Angelina
Los Angeles, US
★★★★★ 5
Insanely good gaming mouse!
This mouse exceeded my expectations in every way. The first thing I noticed was how ridiculously light it feels — it glides so smoothly that aiming in FPS games instantly felt faster and more precise. The wireless connection is flawless with zero lag, and the clicks feel super satisfying and responsive. Battery life has been excellent, USB-C charging is convenient, and the white design looks incredibly clean on my setup. I also love how customizable everything is without feeling overly complicated. Logitech absolutely nailed the balance between performance, comfort, and aesthetics with this one. Easily one of the best gaming mice I’ve used.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
S
Verified Purchase
Solange&Daniel
Chelsea, US
★★★★★ 5
huge difference during long gaming sessions
The Logitech PRO X2 SUPERSTRIKE is easily one of the best gaming mice I’ve used. The first thing you notice is how incredibly lightweight it is—it glides effortlessly, which makes a huge difference during long gaming sessions. The responsiveness is top-tier, and the Lightspeed wireless connection feels just as fast and reliable as a wired mouse. The build quality is excellent, with a clean, minimalist design that looks great on any setup. The clicks feel crisp and precise, and the customizable haptics add a nice touch for those who want to fine-tune their experience. Battery life is also impressive, and the USB-C charging is a welcome upgrade.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026

recommand products