SKU: 20459822680

LILRA5/CD85f/ILT11 His Tag Protein, Human

Sale price$360.00 Regular price$400.00
Save 10%

Pay in installments of $100.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA5/CD85f/ILT11 His Tag Protein, HumanProduct Specification Species Human Synonyms LILRA5, CD85f, ILT11 Accession A6NI73 1 Amino Acid Sequence Gly42 Arg268, with C terminal 8*His GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAGGGSHHHHHHHH Expression System HEK293 Molecular Weight 33 40kDa (Reducing) Purity 95% by SDS

Product Specification


Species Human
Synonyms LILRA5, CD85f, ILT11
Accession A6NI73-1
Amino Acid Sequence Gly42-Arg268, with C-terminal 8*His GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 33-40kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin-like receptor A5 (LILRA5) belongs to a family of receptors known to regulate leukocyte activation, which encoded within the leukocyte receptor cluster (LRC) on human chromosome 19. LIRs are transmembrane proteins containing either two or four extracellular immunoglobulin domains, and most family members are expressed predominantly on myeloid cell lineages. Cross-linking of LILRA5 on monocytes induced production of pro-inflammatory cytokines, suggesting that LILRA5 plays a role in inflammation. Furthermore, LILRA5 induced selective production of pro-inflammatory cytokines as well as IL-10. LILRA5 mRNA and protein expression was tightly regulated by TNF-α, IL-10 and IFN-γ. Increased expression of LILRA5 in rheumatoid tissue, together with its ability to induce key cytokines involved in RA, suggests that this novel receptor may contribute to disease pathogenesis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 20459822680

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Betsy
Belleville, US
★★★★★ 5
One of the best dog toys I’ve found
Color: Blue, Color: Blue
My Great Dane puppy- at 140lbs, loves this!! We had another one that was plastic and it worked ok but this is so much better! Interactive, soft to play with, battery last a long time & he does not get bored with it. Besides is plush lamb chops, best toy ever bought for him.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
K
Verified Purchase
K. Brittain
Fort Morgan, US
★★★★★ 5
Keeps my wild child busy!
Color: Orange
*UPDATE 1/10/26* Does my pup love it? Yes. 5 stars for that. His big thing is just holding it in his mouth though, and laying down with it. Then he will put it down, and as soon as it rolls away he gets up and grabs it again. He definitely requires attention from his humans when it’s turned on…kind of defeats the purpose of why I bought it! He’s a needy boy, that’s for sure, so it’s not the toy’s fault. Two improvements I’d love to see though, are 1) the ability to turn off that yappy bark. I think my dog is more excited about it moving and not so much the yapping. Not that it’s bad, but my boy doesn’t bark much so I’m used to a quieter household. And 2) when removing the base for powering off, there should be a sensor so it doesn’t keep spinning in the socket, occasionally slipping out and hitting the floor. I worry about it breaking due to this. This thing arrived today and we couldn’t wait till Christmas to give it to our high play drive Australian Shepherd. It’s been barely above zero for weeks with no end in sight, and I have cold weather asthma so I really try to limit my exposure to the elements. Needless to say, my dog has been B O R E D. He truly craves interactive play with his humans, but last week I bought a cheap r/c cat toy that really caught his attention. So I splurged on this toy and so far, it’s AWESOME. He can’t control himself when the rope starts spinning. He pounces on it and it goes spinning off and around. He keeps picking it up thinking it’ll stop, but it keeps going. After 5 minutes of play he was acting completely gassed, but he just can’t resist it, as he put it down to get a drink of water and it started spinning again. Forget the water, I need that toy! As long as this thing can handle the teeth, slobber, dirt and grime, I’ll be a repeat customer!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 22, 2025
J
Verified Purchase
Jack H
Louisville, US
★★★★★ 4
My dog loves it...but needs charging four, five times a day. You really need 2 for full-time play
Color: Blue
My dog loves this toy. The first time she saw it and it started rolling, bounding, and waving the ropes around...she was barking at it, chasing it, grabbing it, jumping all over the place. There is no other toy she has that she will leave this for. And...that's part of the problem. I have to take this away from her three, four, five times a day to recharge it. The charge barely lasts an hour and the toy is dead. And it takes over an hour to charge it all the way up. Which means she plays with it less than it spends charging. That's not ideal. The product page and manual that comes with the toy says there is a 10-minute play period followed by a 30-minute interval to let the dog cool down...not get overly stimulated. I have never seen a cool-down period. I don't know if it's because the dog plays with it, shakes it around, tosses it and chases it, etc., etc., etc. constantly...but it just keep going until the battery is dead. I wish it did have a cool-down period. She likes playing with the ropes and rolling it around herself even after the battery dies, so if there was a cool-down, maybe it wouldn't need to be charged many times a day. Once it's charged and she sees me putting it back together, she gets very excited and starts jumping up and trying to grab it. Our corgi reduces most rope toys to threads in a day or less, and this one has held up surprisingly well against her super-chewing habits. The material the ball part is made of is very durable (we have a couple other toys with the same type of shell) and she's chewed on them all a lot without any damage. The toy keeps her entertained and happy...when it's not on the charger. I wish it was a good-enough value for the money to be able to justify buying two of them so I could have one charging while she was playing with the other. ================= I'm adding 1 star, because the company customer service is outstanding. They emailed me about my concerns vis-a-vis the short battery life, and it seemed that they really listened and cared about my input. I don't know what, if anything, can be done to extend the battery life given that it's spinning some substantial pieces of rope around, but I think they'll do as much as they can. In the meantime, my dog's love for this toy has not diminished in the least. She still gets very excited when she sees me starting to put it together after it's done charging, and she ignores everything else (sometimes even offers of treats) to play with it. I have a second one now, and I can almost keep them going full-time, but the few minutes every couple hours when both of them are on the charger is probably good for her anyway...she'd probably be over-stimulated if she had one of these to chase non-stop. Summary: Great toy, lots of fun, my dog loves it. However, you really need two the way things are right now unless you are okay with your dog being able to play less than half the time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026
K
Verified Purchase
K9lover
Omaha, US
★★★★★ 5
My German Shepherd loves it!
Color: Blue
My GSD loves this thing! It bounces and the rope thing wiggles and spins. She is supervised while playing with it. The charge lasts about an hour or so. The only thing that is a little annoying is it makes a little barking sound on one of the settings. It screws apart for easy access. So far she's not been able to destroy it but she has opened it so definitely supervise playing time. It rolls around and bounces on the carpet and on the hard floor it jumps a little bit. Can be loud on hard floors. It's a soft rubber kinda texture that is easy to rinse off and clean. Probably best for indoor use or use on decks or patios. Keeps her very engaged and I have a blast watching her and playing with her with this thing!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
H
Verified Purchase
Holbytla
New York, US
★★★★★ 3
Not for chewers
Color: Blue, Color: Blue
Ok, first off, my dog absolutely loved this toy. Still loves it. However: it only took him two days to utterly destroy the part that made it interactive. The rope fastened to the small interior plastic part that is moved by the rechargeable motor was too soft for him and he chewed it off right at the root, where it attached. This makes the toy immobile. It still makes noise and vibrates, but it no longer leaps and bounces. So now he carries it around while it vibrates inside his jaws and I watch his ears jiggle and make sure he doesn’t eat the whole thing. Please note: this is a medium sized Corgi, not a huge dog like a Rottweiler. There is no way to add a new rope to that interior plastic piece: they are made as an inseparable unit. You have to buy the full replacement set which includes a new cover. I would recommend this toy for someone whose dog is NOT a chewer. For someone whose dog loves to chase, and is excited by noise. If those pesky squirrels chattering outside really get to him, this toy will be his new favorite. But if your dog likes to chew and has more than two teeth in his mouth, this toy is not a great choice and you should spend your money on something that will last a bit longer. It’s not a good value for the money. I bought this original toy and a replacement cover+rope set, and I’m not going to give him the replacement cover for a long, long time. I can’t afford to replace these every few days! Thankfully he still loves the toy despite the fact that it doesn’t run away from him, and hasn’t tried to eat the foam covering, so it’s just the softness of the rope I am disappointed in. But I’m not going to buy this again and can’t recommend it highly, based on my experience, despite my dog loving it and the joy I get watching his ears shake as he trots around the house holding onto this expensive mouth vibrator.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products