SKU: 21856750193

NKp30/CD337 His Tag Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

NKp30/CD337 His Tag Protein, HumanProduct Specification Species Human Synonyms Natural killer protein 30,NCR3,CD337 Accession O14931 Amino Acid Sequence Leu19 Thr138, with C terminal 8*His LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 30 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Natural killer protein 30,NCR3,CD337
Accession O14931
Amino Acid Sequence Leu19-Thr138, with C-terminal 8*His LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 20-30 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Natural killer protein 30 (NKp30; also known as natural cytotoxicity receptor 3, NCR3; or CD337) is an Ig-like activating receptor of NK cells regulating the cross talk between NK and dendritic cells. It is expressed on the surface of NK cells, recently-expanded γδT cells, activated CD8 cells, and innate lymphocytes. The extracellular part of NKp30 consists of a single N-terminal Ig-like domain, followed by a distinct 15 amino acids long stalk region proximal to the plasma membrane, which is important for receptor signaling. Further, three specific cellular ligands of NKp30 have been identified. NKp30 binds a member of B7 family, in particular B7 homolog 6 (B7-H6). Interaction of NCR3 with B7H6 leads to activation of NK cells and induces cytolysis of target cells resulting in apoptotic cell death. Another NKp30 cellular ligand, BAG-6 is recruited to the cell membrane and interacts with NKp30 in some tumor cells or under the stress conditions. The most recently discovered NKp30 ligand, galectin 3, expressed on the surface of some tumors, almost completely blocks NK cell cytotoxicity. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21856750193

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
PHOEBES
Pawtucket, US
★★★★★ 3
REALLY CUTE SHOE BUT CUT WAY TOO SMALL!
Size: 8, Color: Black Patent
I received the black patent leather shoes today and they are so cute! Sadly I need to return them because they are cut way too small. I normally wear a 7.5 or 8 on dress shoes so I ordered the 8. They are so tight across the top that it's uncomfortable as soon as I put them on. They are smaller than a normal size 8 dress shoe. The big toe area is extremely uncomfortable because it doesn't allow any room for it at all, so my big toe just presses against the side and end of the shoe without even walking in them. I have very narrow feet and these still are too small for me. So I am returning them and I already ordered a 8.5 W and hope that will fit much better. The patent leather is very cute and adds just enough dressy that I can wear them with slacks or my Capri jeans. I like the slip on and the cushion foot bed because it feels soft.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
A
Verified Purchase
Amazon Customer
Port Orchard, US
★★★★★ 5
Love these flats!
Size: 9 Wide, Color: Black White Faux Snake Skin, Size: 9 Wide, Color: Black White Faux Snake Skin
One of my favorite pair of flats! I’ve had these for several years and they are still comfortable, in good shape and really add a little spice to my outfits. I can wear these all day and not have any foot pain or discomfort as a result. The quality is good, fit is perfect and I tend to have difficulty with shoes due to bunions. Love these!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
L
Verified Purchase
lunaposas
San Leandro, US
★★★★★ 5
LOVE LOVE.
Size: 7.5 Wide, Color: Beige
I love these shoes so much I had to write a review. So comfortable. Cushioned. Fits perfectly especially if you are more on the wide side. They are soft. Flexible. Easy slip ons you can walk around in all day. I want to try more colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
G
Verified Purchase
Georgette Campbell
Massapequa, US
★★★★★ 5
Great buy
Size: 12 Wide, Color: Black Faux Leather
I absolutely love these Amazon Essentials Belice Ballet Flats! They are so comfortable right out of the box and fit my feet perfectly. I can wear them all day without my feet hurting, which is hard to find with flats sometimes. They’re also really cute and go with almost everything I wear. I find myself reaching for them all the time because they’re both comfy and pretty. Definitely a great everyday shoe, especially for the price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
M
Verified Purchase
Michelle White
Lexington, US
★★★★★ 5
Loooove these shoes!
Size: 7.5 Wide, Color: Chestnut Brown Faux Leather
I have these in several colors, and they’ve become a true staple in my wardrobe. The Amazon Essentials Women's Belice Comfortable Slip-On Ballet Flats are exactly what I look for in an everyday shoe—simple, versatile, and comfortable right out of the box. The slip-on design makes them super convenient for busy days, and they pair effortlessly with everything from jeans to dresses to work outfits. They’re lightweight but still feel supportive enough for all-day wear, and I appreciate that they don’t require a break-in period. The fit is generally true to size, and the variety of colors makes it easy to stock up and rotate depending on the outfit. Overall, these are reliable, easy-to-wear flats that offer great value for the price. Not flashy, just consistently comfortable and practical—which is exactly why I keep coming back to them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026

recommand products