SKU: 22835555651

Human BCMA/TNFRSF17 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 6 - Aug 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human BCMA/TNFRSF17 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 17, B cell maturation protein, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Protein sequence (Q02223 1, Met1 Ala54, with C His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Expression System HEK293 Molecular Weight Predicted MW: 5. 9 kDa Observed MW: 10, 13 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 17, B-cell maturation protein, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Protein sequence (Q02223-1, Met1-Ala54, with C-His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Expression System HEK293
Molecular Weight Predicted MW: 5.9 kDa Observed MW: 10, 13 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22835555651

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Efrain
Dallas, US
★★★★★ 5
Great
Good quality and price. Perfect size fit. Easy to install
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
K
Verified Purchase
Kaya
Natrona Heights, US
★★★★★ 5
Great Quality Filter and Perfect Fit for My 2022 CR-V
I bought this EPAuto air filter for my 2022 Honda CR-V 1.5L, and it couldn’t have been easier to install. It fits exactly like the original — snug and secure — and the whole process took under five minutes without any tools. Just open the air box, pull out the old filter, and drop this one in. The quality feels solid with a sturdy frame and well-made filter material. It’s not flimsy at all, and you can tell it’s built to last. After swapping it in, I noticed the engine felt a bit smoother, and there was a slight improvement in responsiveness, especially during acceleration. I’m also hoping it helps with fuel efficiency over time. Honestly, for the price and convenience, this is a no-brainer. It’s a simple upgrade you can do yourself that helps protect your engine and saves you money on dealership replacements. Highly recommended if you drive a newer CR-V like mine!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 24, 2025
T
Verified Purchase
Tony
Louisville, US
★★★★★ 5
Honda air filter
I am very happy with the air filter, it fitted perfectly in my Honda Civic.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
J
Verified Purchase
J24KT
Los Angeles, US
★★★★★ 5
Size Does Matter
Product: Air Intake Filter Brand: EPAuto Positives: Super affordable and compact. Easy to remove and install, just loosen 4 screws and that’s it. Made with quality and durable material. The filter provides ideal airflow for the engine to function properly. Negatives: None. Overall Impression: I needed a replacement filter for my wife’s car and I didn’t want to spend a small fortune. This item was practically a steal at the list price. No need to spend more money, all the quality and longevity can be had with this filter. My wife drives her car almost every day and that means it gets a pretty good amount of use and lasts about 12 months until I decide to change them again. I would definitely recommend this product to others looking for a similar product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2025
G
Verified Purchase
Garvit
Waukegan, US
★★★★★ 4
Performance was good
my usual to go product for Honda CRV i had for long time. But last item i received I was not happy the quality seems like changed from past products. so far i had no complains. Packaging as always was solid. Performance was good. Lasted for more than mileage mentioned on the product page. Air flow is good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025

recommand products