Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human PTH , His tagProduct Specification Species Human Synonyms Parathormone, Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 1kDa Actual: 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder
Product Specification
| Species | Human |
| Synonyms | Parathormone, Parathyrin |
| Accession | P01270 |
| Amino Acid Sequence | Protein sequence(P01270, Ser32-Gln115, with C-10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:11.1kDa Actual:12kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 to -70 °C as supplied. 6 months. -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Parathyroid hormone (PTH), also called parathormone or parathyrin, is a peptide hormone secreted by the parathyroid glands that regulates the serum calcium concentration through its effects on bone, kidney, and intestine. PTH influences bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within the bone matrix (osteon), in an effort to release more ionic calcium (Ca2+) into the blood to elevate a low serum calcium level. Disorders that yield too little or too much PTH, such as hypoparathyroidism, hyperparathyroidism, and paraneoplastic syndromes can cause bone disease, hypocalcemia, and hypercalcemia.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 21 reviews
Sort
Product Reviews
★★★★★ 5
Impressive and durable
This charger is a fantastic alternative for powering up MacBook Pro, Air, iPad Pro, and other USB-C devices. The charging speed is impressively fast, delivering a full charge to my MacBook Pro in no time. It’s also highly versatile, working seamlessly with my Samsung Galaxy and other USB-C gadgets.
The included charging cable is durable and long enough for flexible use, making it convenient for home, office, or travel. The build quality feels solid and reliable, and it doesn’t overheat even during extended use.
If you’re looking for a high-performance, cost-effective charger, this one ticks all the boxes. Highly recommended for anyone needing a dependable USB-C charger! charger is a fantastic alternative for powering up your MacBook Pro, Air, iPad Pro, and other USB-C devices. The charging speed is impressively fast, delivering a full charge to my MacBook Pro in no time. It’s also highly versatile, working seamlessly with my Samsung Galaxy and other USB-C gadgets.
The included charging cable is durable and long enough for flexible use, making it convenient for home, office, or travel. The build quality feels solid and reliable, and it doesn’t overheat even during extended use.
If you’re looking for a high-performance, cost-effective charger, this one ticks all the boxes. Highly recommended for anyone needing a dependable USB-C charger!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2024
★★★★★ 5
Solid charger for the price
Picked this up as a backup for MacBook Air and honestly its been working great. It is enough to fast charge the laptop even while Im using it which is all I really needed. Also tried it on my iPhone and it works well. Easy to connect, no need to setup anything
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
★★★★★ 5
Durable - Works for my Mac and my kids’ computers
My kids are constantly losing my MacBook charger and they’re expensive! So on Prime Day I treated myself and bought this charger - which I told them they’re never ever allowed to touch under any circumstances.
The brick is pretty big compared to what I’m used to. The cord length is fine and it charges my MacBook quickly just like I wanted it to! I was really pleasantly surprised by how legit this charger is for the price, given how costly they can be. It seems really sturdy.
Turns out, this charger also fits the Chromebooks that all 3 of my kids use for school, and whose chargers are always missing. So “my” charger is once again a shared charger. But it gets all 3 Chromebooks and my laptop fully charged in a night. Nice, easy, durable product for a great price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 16, 2025
★★★★★ 5
Excellent!
Excellent PSU Very High Quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
★★★★★ 1
Sunveza MacBook Pro Charger: A Game-Changer on a Budget!
Man, where was this Sunveza charger when I first got my MacBook Pro? I'm the type who'd forget my head if it wasn't attached, and yup, I did it – forgot my charger on my first day bringing the new MacBook to the office. Enter Sunveza with its high-efficiency and surprisingly affordable solution.
First off, this thing charges FAST. Talking about going 0 to 80% in what feels like a blink. And the compatibility? Spot on. Whether you're rocking a MacBook Pro, Air, or even an iPad, this charger's got you. Plus, the multiple security features? A major bonus. Peace of mind knowing my gadgets are safe from overcharging or short-circuits.
Now, if we're comparing aesthetics, yeah, it doesn't have that Apple "heft." But honestly, does that matter? It's like comparing a sports car by the weight of its keys. What matters is performance, and Sunveza delivers.
I stumbled upon this gem after a less-than-stellar experience with a pricey off-brand from Target. Sunveza's charger is just the right size, doesn't sag from the outlet, and feels just right. The only tiny hiccup? The cable can be a smidge finicky sometimes, needing a gentle push to snugly fit. But considering the overall value and the fact that I could always grab a new cable if needed, it's a minor gripe.
In short, if you're in the market for a MacBook charger that won't break the bank and performs like a champ, Sunveza's got your back. Highly recommend! 🌟🌟🌟🌟🌟
EDIT: Wow okay... so things were working great for several months but then I started having issues with this charger and it would intermittently start and stop charging. The charger block itself would also get painfully hot to the touch. I had been using this product for less than a year when I started having these issues. I tested this out with other devices and outlets and witnessed the same behavior. I also took my MacBook to the Apple Store and they informed me that my battery was damaged, likely because of this charger. In light of this, I can no longer recommend the Sunveza charger.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2023