SKU: 23566562288

Human IL-11 Protein, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-11 Protein, His tagProduct Specification Species Human Synonyms Interleukin 11, Adipogenesis inhibitory factor (AGIF), IL11 Accession P20809 1 Amino Acid Sequence Protein sequence (P20809 1, Pro22 Leu199, with N His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed

Product Specification


Species Human
Synonyms Interleukin-11, Adipogenesis inhibitory factor (AGIF), IL11
Accession P20809-1
Amino Acid Sequence

Protein sequence (P20809-1, Pro22-Leu199, with N-His tag) PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20-26 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IL-11 (Interleukin 11) is a pleiotropic cytokine in the IL-6 family. IL-11 is secreted by osteoblasts, synoviocytes, fibroblasts, chondrocytes, intestinal myofibroblasts, and trophoblasts, among other cell types. It is found in the plasma mainly during inflammation, such as that associated with viral infection, cancer, or inflammatory arthritis, and is considered to be primarily anti‑inflammatory. It stimulates hematopoiesis and thrombopoiesis, regulates macrophage differentiation, and confers mucosal protection in the intestine. It has also been found to enhance T cell polarization toward Th2, promote B cell IgG production, increase osteoclast bone absorption, protect endothelial cells from oxidative stress, and regulate epithelial proliferation and apoptosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23566562288

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
snowyh
Houston, US
★★★★★ 4
Not for Aggressive Chewers
Cute stuffed dino with one large squeaker in the body and crinkle paper in the feet and tail. The right size for medium to large dogs. Riley was eager to play tug-of-war with this toy when I first gave it to her. Five minutes later the novelty had worn off and she went to her toy basket to bring out her usual favorites. Being plush, this is not really a toy for aggressive chewers--after only 5 minutes she had torn open a seam and ripped off part of the tag. I'll continue to let her play with it until stuffing starts coming out (which shouldn't be long).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025
B
Verified Purchase
Bridget R Crouse
Waukegan, US
★★★★★ 5
Durable
Color: Multicolor A, Size: 2.5"(Medium)-12 Pack
Our dogs love these balls. They seem to be sturdy for our strong jawed dogs and they love the squeaker. We haven't had to replace the first two balls we e had out playing with yet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
J
Verified Purchase
J&J
Los Angeles, US
★★★★★ 5
Doggie approved
Color: Orange - Light Blue, Size: 2.0"(Small)-4 Pack
Great price and my dogs love them we gifted one to another dog and he was happy as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
J
Verified Purchase
Jenny
Battle Creek, US
★★★★★ 5
All squeaker ball companies need to start doing this!!!!
Color: Orange - Pink, Size: 2.5"(Medium)-4 Pack
So first thing I want to say is that the manufacturer of these balls has thought of something that I am honestly shocked nobody has yet thought to do. They put the squeaker reed UNDER the fuzzy shell. GENIUS! I mean really, why aren't all squeaker ball companies doing this?!?! No wondering when it will finally pop out (or in) and it definitely prolongs the life of the squeaker significantly. My staffordshire/pit bull mix adores her squeakers, that said, they never last long especially when they are in a ball (her absolute fav toy on earth) The squeaker being protected alone warrants a 5 star review because it is simply genius. The fuzzy shell has yet to deteriorate and we have had these balls now almost 3 months so they have already outlasted other brands too. Now as for the sound itself, it is definitely different from a typical squeaker, not necessarily a bad thing. It is a "mild" squeak, not obnoxious a bit high pitched. Sounds more like a baby toy squeaker than a dog toy squeaker though....I'm not quite sure how I feel about the squeak. My dog has a preference for squeaker sounds. She prefers the little squeaker sound over the deeper louder sound from the bigger squeakers, these are closer to the sound she prefers but she doesn't LOVE it like I had hoped. The only other thing is that the ball itself feels as though it was blown up and plugged tight. Meaning (and believe me when I tell you my dog has a strong jaw) it is harder than most to make these balls squeak because you can't squeeze all the way down on the ball. It takes me two hands to make them squeak so my dog has a tough time squeaking them. She continually tries though so they are keeping her occupied. Overall I do recommend these balls because they are far safer than most eliminating the concern for your dog accidentally eating the squeaker and the longevity of their potential life. Try em, they are rugged enough for heavy chewers alike!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2025
J
Verified Purchase
Janice
Houston, US
★★★★★ 4
Tough enough to take rough play.
Color: Multicolor A, Size: 2.0"(Small)-6 Pack
They are smaller than I thought. That’s on me because I didn’t see the size. My dog loves them anyway and they are sturdy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026

recommand products