SKU: 24678485783

B7-H5/VISTA His Tag Protein, Mouse

Sale price$279.00 Regular price$310.00
Save 10%

Pay in installments of $77.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

B7-H5/VISTA His Tag Protein, MouseProduct Specification Species Mouse Accession Q9D659 Amino Acid Sequence Phe33 Ala191, with C terminal 8*His FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAGGGSHHHHHHHH Expression System HEK293 Molecular Weight 33 43 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Mouse
Accession Q9D659
Amino Acid Sequence Phe33-Ala191, with C-terminal 8*His FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 33-43 kDa(Reducing)
Purity

>95%  by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

B7-H5, also known as VISTA, is one of the negative immune checkpoints of the B7 family. B7-H5 which is the most conserved among the B7 membersis mainly expressed in myeloid cells such as macrophages, monocytes, dendritic cells, and T cellsVISTA is a type I transmembrane protein consisting of a single N-terminal immunoglobulin (Ig) V domain, an approximately 30 amino acid (aa) stalk, a transmembrane domain, and a 95 aa cytoplasmic tail. It can regulate a variety of immune cells, including B cells, T cells, and endothelial cells by binding to its putative receptor(s) on these cells.The expression of B7-H5 is closely related to the diagnosis, severity and prognosis of tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24678485783

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Rocky hardcore
Lowell, US
★★★★★ 5
Easy instructions, comfortable cushions
Color: Pink
I just put it together and I love it!!! It's so comfortable and it was easy to put together. You can rock it back and forth which helps your back. The seat is very wide and the cushion is thick. Pink is my favorite color, and this chair satisfies my pink obsession.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
L
Verified Purchase
LA Living
Battle Creek, US
★★★★★ 5
Wonderful chair
Color: Dark Black
I bought this office chair as a sewing tool, you might say. I felt that having an office chair on wheels would get me from the sewing machine to the ironing board and then to the cutting board and back to the sewing machine. I was having to get up and down to get around to all these places before and this saves me so much time and effort. I’m 71 so when the box came I was hesitant to try to bust into it and put it together but it went together so easily. It’s very comfortable and the lumbar support feels great on my low back. When I first sat down after the assembly process, the chair cushion tipped down in the front but after contacting the support team I was advised to tighten the tilt tension located under the chair and that fixed me right up! All and all, my chair is the perfect addition to my sewing area at a very affordable price. I couldn’t be happier!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2024
S
Verified Purchase
SP
Whiting, US
★★★★★ 4
Comfortable, affordable, and great for small spaces!
Color: Light Purple, Color: Light Purple
I had previously left a review of two stars, but have since deleted that review after I've owned the chair for a few weeks now. Initially, I stated the chair was uncomfortable and not cushioned at all. But this issue quickly resolved after sitting it for a longer time, it seems the cushion molds to you. So it may be uncomfortable the first few times sitting on it, but it eventually softens. The cushion is now soft yet sturdy. You don't sink in too much, but it's comfortable for sitting for long periods of time. I personally enjoy the mesh back as well, it supports my lower back and doesn't cause back pain. Normally I have to use a cushion of my own to support my lower back for most chairs, but this one actually supports me in a way that doesn't require an extra cushion - so that's really nice. The chair is fairly on the smaller end, which is perfect for low desks or tight spaces, which is exactly what I wanted. The height can be adjusted, but even at the highest setting, it is still fairly low. Keep that in mind - it may not be super comfortable for those over 6 ft. The arms flip up which makes storing it under a low desk very easy. The cushion is thick and very accurate to the picture. I love that it is lightweight and doesn't make much noise when rolling the chair. It also feels very sturdy. Some of the reviews say it feels flimsy, and I don't know if some are just assembling it incorrectly, because for me this thing is very strong and holds up quite nicely under my weight. Overall, this is exactly what I wanted for my personal living space. A chair that's not too bulky, but comfortable enough to sit in for long hours. It functions as advertised for this purpose. One final thing -- the color selection is gorgeous. I bought the light purple color and it fits my setup nicely! Color was accurate to the picture, and looks very cute and adorable in my space.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2025
C
Verified Purchase
Christine Franzone
Lexington, US
★★★★★ 5
Exteremly comfortable
Color: Dark Black
Reasonably priced, very comfortable l, easy assembly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
J
Verified Purchase
James F Evans
Battle Creek, US
★★★★★ 5
Surprisingly amazing chair!
Color: Pink, Color: Pink
tl;dr: If you need a chair that has the features of this one, then this one is a winner! Hits above its weight class for sure. My wife is 5’. She’s small. For whatever reason she ended up with a chair made for big people, like 6+ feet and up to 500lbs type of a chair. She’d often even sleep on it and chill on it. The chair was big enough to fit 2 of her to be honest. It was an expensive chair that I won at some raffle and didn’t like myself. Over the years it ripped (got a cover for it) and even started to get lopsided (from the sleeping) and finally a spring broke (hence the pillow on it in the pictures) She obviously lives pink. I also wanted to get a chair where she could work and not end ip asleep on. Not like we have a couch or a bed for that 😂. This chair is very obviously smaller than her previous chair, it’s also significantly cheaper in price and build, it’s also not as durable feeling or stable, and it’s just not as padded. Yet somehow it’s an amazing chair that we both like better than her previous chair??? Like it’s crazy that this chair somehow works better in so many ways. Her desk is modified to be shorter than normal desks (again, she small lol) and her previous chair was just too big. The wheels are also like SUPER smooth, like you can run a chair race easily with it. It rolls over her rug and tucks into her desk (which is in our bedroom) easily. The amount of space this has save us when the chair isn’t being used is a lot. Previous chair was much bigger and didn’t tuck in at all. The color is nice and the padding is plenty for a small and much lighter than 500lbs woman. I’m 6 feet and 200 lbs and the chair is nice for me as well. My chair is bigger and more secure in the backing, which is similar to this one. The lowest tension setting on my chair is still too high for her to lean back on my chair. This chair has a lower tension minimum and she can easily lean back freely, as well as keep enough tension to work without sagging. This chair is surprisingly outstanding! I’m sure my wife will destroy it quicker than the last one, but it’s so cheap that even if it only lasts 1-3 years, I’ll happily buy it ones or twice more 🤷🏽‍♀️. Maybe by then they’ll invent a comfortable titanium chair that’s affordable that she won’t destroy 😂.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2024

recommand products