SKU: 24810629210

Human FDX1 Protein, His Tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FDX1 Protein, His TagProduct Specification Species Human Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin 1, Hepatoredoxin, ADX Accession P10109 Amino Acid Sequence Protein sequence (P10109, Ser61 Ser184, with C His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Expression System E. coli Molecular Weight Predicted MW: 15. 4 kDa Observed MW: 13 kDa Purity 90% by SDS PAGE

Product Specification


Species Human
Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin, ADX
Accession P10109
Amino Acid Sequence

Protein sequence (P10109, Ser61-Ser184, with C-His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Expression System E.coli
Molecular Weight Predicted MW: 15.4 kDa Observed MW: 13 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

FDX1, or ferredoxin 1, is an essential mitochondrial iron-sulfur protein that functions as a critical electron carrier in several fundamental biochemical pathways. Primarily located in the mitochondrial matrix, it shuttles electrons from NADPH via ferredoxin reductase to key enzymes involved in steroidogenesis, heme biosynthesis, and iron-sulfur cluster biogenesis. By facilitating these electron transfer reactions, FDX1 plays a central role in cellular metabolism, energy production, and the synthesis of vital biomolecules. Recent research has also highlighted its significant role in regulating copper-dependent cell death (cuproptosis), making it a protein of growing interest in cancer biology and therapeutic development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24810629210

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amber L.
Chelsea, US
★★★★★ 5
Planning on sharing the ones I didn’t care for.
I feel I have to give this a five star rating because it did come just as described, my only negative is my own personal fragrance choices. I only found two that I liked one of which I already had. I can’t take stars off for that because others may absolutely love the rest, but I can tell you that the packaging was just as seen, and it came well protected.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2025
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 1
Terrible scents
Style: 6 Piece Discovery Set 2
If you want to smell like an old lady, this is the perfume set for you. The only semi okay scent is Santal, all the rest are unwearable and smell terrible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
S
Verified Purchase
Susanna
Bozeman, US
★★★★★ 5
Good Scents!!!
Enjoying the choices of lake&skye perfumes, haven’t found one I didn’t like;)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2025
A
Verified Purchase
aberfitchgr534
San Leandro, US
★★★★★ 3
Nothing Great & Not Long Lasting
Style: 6 Piece Discovery Set 2, Style: 6 Piece Discovery Set 2
Ordered this sample set to see which scent I liked best before committing to a whole bottle. Honestly none of them were a favorite or a scent I would want a whole bottle of. I liked the 11 11 out of all of them. The Midnight was the worst and I felt like it didn't fit the rest of the scents, it was very strong. I also wouldn't order any of these because the scent is not long lasting, or atleast it isn't on me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2025
C
Verified Purchase
C. Boutelle
Houston, US
★★★★★ 5
Belgian Malinois approved
Size: Large
This ball was the perfect choice for my 8 month old Belgian Malinois. Should last for years so far it has survived all her chewing needs. It’s the perfect size so I don’t have to worry about her swallowing it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026

recommand products