SKU: 2492859392

Human CD8 alpha&beta (CD8A&CD8B) Heterodimer Protein, His Tag&Flag Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD8 alpha&beta (CD8A&CD8B) Heterodimer Protein, His Tag&Flag TagProduct Specification Species Human Synonyms CD8 Amino Acid Sequence Protein sequence (P01732, Ser22 Asp182, with C Acidic Tail His tag) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Protein sequence (P10966, Asn19 Pro170, with C Basic Tail Flag tag)

Product Specification


Species Human
Synonyms CD8
Amino Acid Sequence

Protein sequence (P01732, Ser22-Asp182, with C-Acidic Tail-His tag) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD Protein sequence (P10966, Asn19-Pro170, with C-Basic Tail-Flag tag) NSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP

Expression System HEK293
Molecular Weight Predicted MW: 23.9 kDa(CD8A)&22.7 kDa(CD8B) Observed MW: 30, 35 kDa under reducing (R) condition, and 65-72 kDa under non-reducing (NR) condition
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD8 (cluster of differentiation 8) is a transmembrane glycoprotein expressed on cytotoxic T lymphocytes, serving as a coreceptor for the T cell receptor (TCR). It exists primarily as a CD8αβ heterodimer or a CD8αα homodimer, each chain belonging to the immunoglobulin superfamily. Functionally, its extracellular IgV-like domain binds the α3 domain of MHC class I molecules, stabilizing the TCR-antigen interaction. Concurrently, its cytoplasmic tail recruits the kinase Lck to initiate intracellular signaling cascades crucial for T cell activation and target cell killing. CD8 is thus essential for adaptive immunity against viruses and tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2492859392

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LylaStylus
New York, US
★★★★★ 5
The Only SPF My Skin Will Tolerate!
Style: 4 Fl Oz (Pack of 1)
After 20 rounds of radiation, I was given a list of exactly four things I could put on my face--things like water and Vaseline. Of course, I was also instructed to wear SPF in "all visible light." However, finding a sunscreen my skin could tolerate proved to be a challenge, as even those made with clean ingredients, marketed for babies, and/ or claiming to be hypoallergenic resulted in hot, angry rashes. Price point also didn't matter; I tried everything from drugstore to premium brands. Thankfully, when this product came on the market, my dermatologist suggested I try it. I've been wearing it ever since. It IS thick so I usually rub any remaining face moisturizer into my palms and then add the Sunscreen, rubbing and warming it between my palms to make it more easily spreadable. Then I press it onto the skin on my face with my palms and fingers--I don't like to pull or tug too much at the skin on my face. At first, there is a visible white cast, but it disappears within a couple of minutes. If I'm really in a hurry, now I can mix a tiny bit of my foundation into the sunscreen so that it spreads faster and I can move on from the white cast faster--I know I lose some sun protection factor that way, but my derm says I also gain some protection in the tinting, so it's okay. The important thing is that I get it on in whatever time I have. I'm just grateful to have found something that doesn't upset my crazy-sensitive skin! Wishing all you sensitive beauties protected fun in the sun...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
C
Verified Purchase
Christina A.
Pawtucket, US
★★★★★ 4
Good sun protection without chemicals, without a high price.
Style: 4 Fl Oz (Pack of 1)
I've bought this a couple of times. I feel like it gives excellent sun protection at a reasonable price. I mostly use it on my face. When I first apply it, it looks a little white and pasty, but it doesn't take long for that to go away. It's a little greasy at first , but I have dry skin, so I it absorbs in. I like using a sunscreen that doesn't have a lot of chemicals. This works well while using ingredients I feel good about putting on my skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 13, 2025
T
Verified Purchase
TD
Battle Creek, US
★★★★★ 5
A very effective sunscreen at a very reasonable price
Style: 4 Fl Oz (Pack of 1)
This sunscreen is very reasonably priced but would I love about this product more than anything is how effective it is at protecting your skin and will be my first go to when purchasing a sunscreen, and for a man, it is best to be clean shaven when using, and not to put on too much as it will make you look like Casper the ghost if you do
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
A
Verified Purchase
Alvin English
Birmingham, US
★★★★★ 5
No scent and blends in surprisingly well.
Style: 4 Fl Oz (Pack of 1)
Eucerin 50 (Sensitive Mineral - Zinc Oxide) Expiration date: Sept. 2026 Purchase date: May 2025 The most noticeable ingredients in the sunscreen are zinc oxide, mineral oil, and a yellow tint. The sunscreen is not scented which is always a plus. The yellow tint was not noticeable on my deep bronze skin. My skin is sensitive to many chemical products but not this one. The product blended in well into my skin both when dry and when using a moisturizing toner. There was not a white cast after giving it a few minutes to be absorbed by the skin. Most oil-based sunscreens leave my skin feeling greasy when perspiring but the Eucerin 50 was a pleasant surprise. The perspiration felt normal and not greasy. Overall, I am very pleased with the product. It is great for active people who normally sweat away sunscreen. Eucerin 50 left my skin feeling very soft after washing it off. This is the first mineral oil-based sunscreen that I have found to be satisfactory. I believe it to be a good value at the twenty-dollar or less price range. Warning!: It can stain your clothing. Do not store oil-based sunscreens in a hot environment like your automobile. The ingredients will separate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2025
M
Verified Purchase
mawissacee
Pawtucket, US
★★★★★ 5
I've tried MANY sunscreens. This is the best for the money you can buy.
Style: 4 Fl Oz (Pack of 1)
I have a section in my closet reserved for the graves of past sunscreens. And there are A LOT. Reasons why this is the best for price point: 1. No white cast. Maybe 2%. Yes, there is a bad a white cast when you first put it on, especially if your face is still a tad damp from washing. But it almost completely disappears within minutes. And this is coming from someone who is of Southeast Asian descent, and currently have a natural a tan this time of year. I get tan because I don't apply it every 2 hours as recommended. I only use it when I'm working out outside and the sun is blasting my face. I live where it gets very sunny. 2. NOT oily. I have super oily skin and so many of my sunscreens makes my face more of an oil slick than normal. I have matiffying ones, that work well, but it gets expensive. 3. Fragrance free! I prefer to use as many fragrance-free products as possible. 4. DOESN'T STING EYES. I'm surprised at how many "sunscreens for the face" are out there that absolutely sting my eyes into waterworks. 5. Price-point. A giant tube (for the face) for all that? It will take me a very long time to go through it. For my body, I use cheaper fragrance-free mineral sunscreens, or sunscreens I want to get rid of. 6. I use a moderate strength prescription of Tretinoin, and those who know, know that without sun protection, the skin can get burned and irritated extremely easily. Not me! And I use Tretinoin every single night. I'm so glad Eucerin made this, I hope they never discontinue this!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2022

recommand products