SKU: 25172299126

TREM2 Fc Chimera Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TREM2 Fc Chimera Protein, HumanProduct Specification Species Human Antigen TREM2 Synonyms TREM 2, Triggering receptor expressed on monocytes 2 Accession Q9NZC2 1 Amino Acid Sequence His19 Ser174, with C terminal Human IgG1 Fc

Product Specification


Species Human
Antigen TREM2
Synonyms TREM-2, Triggering receptor expressed on monocytes 2
Accession Q9NZC2-1
Amino Acid Sequence

His19-Ser174, with C-terminal Human IgG1 Fc HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Deczkowska A, Weiner A, Amit I. The physiology, pathology, and potential therapeutic applications of the TREM2 signaling pathway. Cell. (2020) 181:1207-17. 10.1016/j.cell.2020.05.003 2. Guerreiro R, Wojtas A, Bras J, Carrasquillo M, Rogaeva E, Majounie E, et al.. TREM2 variants in Alzheimer's disease. N Engl J Med. (2013) 368:117-27. 10.1056/NEJMoa1211851 3. Molgora M, Esaulova E, Vermi W, Hou J, Chen Y, Luo J, et al.. TREM2 modulation remodels the tumor myeloid landscape enhancing Anti-PD-1 immunotherapy. Cell. (2020) 182:886-900.e817. 10.1016/j.cell.2020.07.013.

Background

Triggering receptor expressed on myeloid cells-2 (TREM2) is a transmembrane receptor of the immunoglobulin superfamily and a crucial signaling hub for multiple pathological pathways that mediate immunity. Expressed in the brain, specifically in microglia and in the fusiform gyrus. TREM2 can inhibit the phagocytic function of dendritic cells and macrophages, thereby affecting related immune signaling pathways. TREM2 has vital roles in Alzheimer's disease and other neurodegenerative diseases, and is involved in numerous immune and inflammatory pathways that contribute to the etiology of these diseases. TREM2 has been studied widely in microglia, where TREM2 functions in neuronal debris clearance to counteract the inflammatory response. TREM2 can alter the morphology of tumor-infiltrating macrophages, inhibit tumor growth, and enhance checkpoint blocking therapy. TREM2 can function as a prognostic marker in various malignant tumors because of its role in tumorigenesis and tumor immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25172299126

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
demmie thomas
Alexandria, US
★★★★★ 5
Blanket
Size: Twin (60x80 Inch), Color: Grey
This blanket is one of those go-to affordable staples—super soft, lightweight, and perfect if you want something cozy without feeling heavy or bulky. ⸻ 👍 What stands out * Soft microfiber fleece – smooth and cozy against the skin * Lightweight but warm – good balance for all seasons * Perfect twin size (60x80) – fits beds, couches, or layering * Clean, simple design – grey goes with everything * Durable stitching – double-needle edges help it last longer
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
J
Verified Purchase
Julie R
Waukegan, US
★★★★★ 4
Soft and cozy, sizing seems a bit inconsistent
Size: Queen (90x90 Inch), Color: Sage Green
I actually ordered two of these blankets in two different colors. We had urgent need to add a bed with all new bedding (medical reasons), so I ordered these blankets in a rush. The quality of the blankets seems good. They are very soft and cozy. Lightweight, yet warm. The only issue is that two blankets that should be identical in all ways other than color are actually not even close in size. No matter how hard I try, I cannot get these blankets to line up equally. I really don't like having one blanket hanging lower than the other, especially now that this bed is just inside our front door where every visitor can see it. The king size quilt should in theory cover this discrepancy, but it doesn't fit correctly (another issue). It also means that the blankets are not equally distributed over me and my husband at night. Other than the size inconsistency, I really like these blankets and think they are good value, plenty warm for Wisconsin winters when doubled up with sheets and quilt.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
A
Verified Purchase
Ant Farmer 1
Waukegan, US
★★★★★ 5
Soft fuzzy polyester king sized fleece blanket with no static electricity
Size: King (90x102 Inch), Color: Grey, Size: King (90x102 Inch), Color: Grey
I ordered the gray color because it was cheaper than the other colors, but it looks nice. This blanket was actually a lot nicer than I was expecting. It is pretty thick, very soft, fuzzy on both sides, fits the king sized bed, and keeps me warm with little extra weight. It is breathable and doesn't make me sweaty. The price was really very good, better than what I saw when shopping in local big stores. This feels great on the skin, and is much more comfortable than heavy wool blankets or quilts. When folded up it doesn't take up much room. It fits well in the washing machine. One of the best features is that it doesn't seem to generate static electricity even in dry air. In general I don't care for synthetic fibers, but I'm making an exception with this blanket, which stays clean and fluffy after extended use. I've had it 2.5 months with no problems and no manufacturing defects detected. The hem stitching is tidy and strong, very neat. I'm thinking of ordering a smaller one to keep in the car for emergencies and outings. I wish all the colors were a similar low price. I have recommended this blanket to friends.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
L
Verified Purchase
Laurie Ebert
Boise, US
★★★★★ 5
Best blankets ever
Size: King (90x102 Inch), Color: Navy
Gorgeous blanket. I have many of them. They wash up great and look good. They are soft and warm. I only returned this one because the color was off. It looked more like a light to medium blue, but is actually a very light blue.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
D
Verified Purchase
Daniela M Gutierrez Toledo
Lake Worth, US
★★★★★ 5
Super soft, cozy and lightweight blanket
Size: King (90x102 Inch), Color: White
I absolutely love my blanket. It’s super soft and very comfortable, and it looks really beautiful. It keeps you warm, but it’s not very thick it’s on the lighter side. Even so, I highly recommend it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026

recommand products