SKU: 25793485101

HRV 3C Protease

Sale price$405.00 Regular price$450.00
Save 10%

Pay in installments of $112.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HRV 3C ProteaseProduct Specification Species Human Rhinovirus Synonyms PPase, PSP,Human rhinovirus 3C protease, HRV3C Accession P03303 Amino Acid Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSGPNTEFALSLLRKNIMTITTSKGEFTGLGI HDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFR

Product Specification


Species Human Rhinovirus
Synonyms PPase, PSP,Human rhinovirus 3C protease, HRV3C
Accession P03303
Amino Acid Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSGPNTEFALSLLRKNIMTITTSKGEFTGLGI HDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFR DIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMAGLI NLSSTPTNRMIRYDYATKTG QCGGVLCATGKIFGIHVGGN GRQGFSAQLKKQYFVEKQ

Expression System E.coli
Molecular Weight 46.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 20 mM Tris, 200 mM NaCl, 1 mM DTT, pH7.4 ,10% glycerol
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25793485101

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Amazon Customer
Charlottesville, US
★★★★★ 5
Crawfish that cleans her teeth and tastes like bacon, enough said.
Size: Medium & Large, Color: Red Scorpion, Size: Medium & Large, Color: Red Scorpion
This chew toy is for a medium to large-sized dog and smells like bacon, and who doesn't love bacon? The toy has a heavy-duty safe for dogs nylon core, making it virtually indestructible for aggressive, all-day chewers like my dog. I am from Louisiana, and I love all things crawfish. I thought if she didn't like it, then I could use it to decorate for crawfish parties, but she loves this toy. There is a groove for treats like peanut butter or cheese, whatever your dog is into. My dog likes carrying it around, but I don't think she understands to chew on it yet. However, she must love the bacon taste in her mouth because she hardly takes it out. I wanted her to chew on it to help clean her teeth; maybe in time, she will start. This toy is dishwasher safe after rinsing it off with soapy warm water. Just place it on the top rack and turn it on. The crawfish is smooth and non-porous, so there are no spots for bacteria to hide. I really like this crawfish, and I hope that in time my little weirdo will understand that it is meant to be chewed, not sucked on. I highly recommend this for larger dogs that love to chew, and I am happy with this order.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
J
Joe’s Garage
Dallas, US
★★★★★ 1
Our dogs wouldn’t touch this chew toy
Size: Medium & Large, Color: Red Scorpion, Size: Medium & Large, Color: Red Scorpion
I ordered this Bacon Flavored Nylon Chew Toy for my boxer mix dog. She sniffed it and wouldn’t have anything to do with it. We waited a day and still no luck. We figured that we would give it to our pit bull because she can annihilate a chew toy. Nope, she wouldn’t touch it. The thing looks like a big chunk of plastic with a very faint smell of bacon. Based on our experience with this product I cannot recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
K
KandS
Carnegie, US
★★★★★ 5
Surprisingly Tough Chew Toy for Aggressive Chewers
Size: Medium & Large, Color: Red Scorpion, Size: Medium & Large, Color: Red Scorpion
This chew toy is made from a very hard nylon style material and feels substantially tougher than the average dog toy. It definitely seems geared toward aggressive chewers and larger dogs that destroy softer toys quickly. Our pup immediately liked it, especially with the peanut butter groove feature, which helped keep them interested longer. The toy feels almost indestructible during normal chewing sessions and has held up very well so far with no major gouges, cracks, or chunks coming off. Based on first impressions, I would expect this to last at least a month or more for many dogs, which is far better than a lot of chew toys in this price range. Another nice bonus is that it is dishwasher safe, making cleanup easy after using peanut butter or other treats in the groove. As for the teeth cleaning claim, I honestly cannot comment much on that yet. I have not personally noticed any obvious difference in our dog’s teeth or dental condition from using it. Still, as a durable boredom relief chew toy for aggressive chewers, it has been a solid performer so far and seems like a good value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
M
Mia’s-Vine-xperience
Dallas, US
★★★★★ 5
My dog approves
Size: Medium & Large, Color: Red Scorpion, Size: Medium & Large, Color: Red Scorpion
My dog absolutely loves these flavored chew bones! She’s a very aggressive chewer, and this toy has held up really well to her constant chewing. It keeps her entertained for a long time and seems to be one of her favorite toys. I also love the unique scorpion shape. Living in the desert, we see scorpions pretty often, so I thought it was a funny and fitting design. While I don’t expect it to turn her into a scorpion hunter, it definitely adds a fun touch! The flavor keeps her interested, and the durable material makes it a great option for heavy chewers. Overall, a great toy that has been a huge hit with my pup. Will definitely be purchasing more!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
W
Whoknew?
Massapequa, US
★★★★★ 5
Cheaper than shoes!
Size: Medium & Large, Color: Red Scorpion, Size: Medium & Large, Color: Red Scorpion
Instant hit with a dog that likes chewing shoes! This is a much cheaper alternative than a new pair of shoes. They state it is indestructible but at the same time the directions state when it reaches a certain chewed up point to take it away. So obviously this is destructible but it does allow for a lot of chewing. I can not personally attest to the flavor but it must be good because the dog wanted this chew before i even unwrapped it. It is somewhat ugly in both color and shape but I have had no complaints from the dog! I also appreciate that this can be put in the dishwasher to clean. To be honest i have never considered that with other toys and I do appreciate that it can be placed in the dishwasher. Most importantly, this lasts, the dog is in love with this, there are multiple limbs for the dog to chew. It’s his new favorite toy and worth every bit of the cost!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026

recommand products