Pay in installments of $37.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Brain Natriuretic Peptide Protein, HumanProduct Specification Species Human Synonyms Brain natriuretic peptide 32, Gamma brain natriuretic peptide, B type Natriuretic Peptide, GC B, BNP 32 Accession P16860 Amino Acid Sequence SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Expression System E. coli Molecular Weight 3. 5 kDa (Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris HCl, 200mM NaCl,
Product Specification
| Species | Human |
| Synonyms | Brain natriuretic peptide 32, Gamma-brain natriuretic peptide, B-type Natriuretic Peptide, GC-B, BNP-32 |
| Accession | P16860 |
| Amino Acid Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Expression System | E.coli |
| Molecular Weight | 3.5 kDa (Reducing) |
| Purity | ＞95%, by SDS-PAGE under reducing conditions |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris-HCl, 200mM NaCl, pH8.5 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Brain-type Natriuretic Peptide (BNP) is a nonglycosylated peptide that is produced predominantly by ventricular myocytes and belongs to the natriuretic peptide family. Proteolytic cleavage of the 12 kDa BNP precursor gives rise to N-terminal Pro BNP (NT-proBNP) and mature BNP. N-terminal proB-type natriuretic peptide (NT-proBNP), a useful marker of heart failure (HF), is considered to be secreted mainly from the ventricle, increased serum NT-proBNP levels are also encountered in conditions such as atrial fibrillation (AF) and atrial septal defect in patients without HF.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy