SKU: 27412412707

Human IL-12 p70, His tag

Sale price$222.75 Regular price$247.50
Save 10%

Pay in installments of $61.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-12 p70, His tagProduct Specification Species Human Synonyms Programmed cell death 1, CD279, Programmed death receptor 1 Accession P29459,P29460 Amino Acid Sequence Protein sequence (P29459+P29460, Arg23 Ser219+Ile23 Ser328, with C 10*His)

Product Specification


Species Human
Synonyms Programmed cell death-1, CD279, Programmed death receptor 1
Accession P29459,P29460
Amino Acid Sequence

Protein sequence (P29459+P29460, Arg23-Ser219+Ile23-Ser328, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS+IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 60kDa Actual: 70kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied. 

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.

Background

Interleukin 12 (IL-12) is an interleukin that is naturally produced by dendritic cells, macrophages, neutrophils, and human B-lymphoblastoid cells (NC-37) in response to antigenic stimulation. IL-12 belongs to the family of interleukin-12. IL-12 family is unique in comprising the only heterodimeric cytokines, which includes IL-12, IL-23, IL-27 and IL-35. Despite sharing many structural features and molecular partners, they mediate surprisingly diverse functional effects. IL-12 is involved in the differentiation of naive T cells into Th1 cells and plays an important role in the activities of natural killer cells and T lymphocytes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27412412707

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Karen
Lowell, US
★★★★★ 5
Variety
Flavor Name: Variety Pack, Size: 12 Fl Oz (Pack of 12)
Great variety of flavors, doesn’t make you jittery from caffeine, perfect size and great taste
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
J
Verified Purchase
Jackson
Bozeman, US
★★★★★ 4
cleaner caffeine hit, some flavors better than others
Flavor Name: Variety Pack, Size: 12 Fl Oz (Pack of 12)
Been going through this variety pack for a few weeks now and it's become a solid pre-workout alternative. 180mg caffeine from natural sources hits noticeably cleaner than the usual energy drinks — no jittery spike and crash. The sparkling texture is satisfying without being overly carbonated. Flavor-wise the variety pack is hit or miss. A couple of the flavors are genuinely good, a couple I'd skip if buying singles. The zero sugar formula doesn't have that artificial sweetener aftertaste that ruins a lot of "healthy" energy drinks, which I appreciate. The price is a bit higher than standard energy drinks but you're paying for the cleaner ingredient list. If you care about what's in your drinks, it's worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
D
Verified Purchase
Debra Mataya
Alexandria, US
★★★★★ 5
The best ever!
Flavor Name: Variety Pack, Size: 12 Fl Oz (Pack of 12)
I lost my taste for coffee so I ended up trying several different energy drinks. Most of them are very, very unhealthy. However, I found this one “Bloom“. It is refreshing and has enough caffeine to keep me happy. The flavor is great except that I wish they would not use sucralose. It is not necessary.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
S
Verified Purchase
Sammie Jo
Natrona Heights, US
★★★★★ 5
Almost tastes like chocolate milk!
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
I usually dislike protein drinks. But I need It, and this one actually almost tastes like chocolate milk. I’ve tried the other flavors of this brand, and for me, this is the least protein tasting one. Banana came close.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
A
Verified Purchase
Abhigna Kajiwala
Grantham, US
★★★★★ 5
The Gold Standard: Premier Protein Chocolate Shake
Flavor Name: Chocolate, Size: 11.5 Fl Oz (Pack of 12)
The Premier Protein Chocolate Shake is, in my opinion, the benchmark for ready-to-drink protein shakes. Whether you're a serious athlete, a busy professional, or someone trying to hit daily protein goals, this shake delivers on taste, convenience, and macros. Taste & Texture (Surprisingly Good) Let's be honest: most shelf-stable protein shakes taste like chalky chemicals. This is where Premier Protein shines. The Chocolate flavor is rich, creamy, and surprisingly satisfying without being overly sweet. It tastes like a genuine, albeit light, chocolate milk. Crucially, the texture is smooth and velvety; there is virtually no grittiness or unpleasant artificial aftertaste. I genuinely look forward to drinking these, which is half the battle with supplements. They are best enjoyed ice-cold! Unbeatable Nutritional Profile The macros are what make this shake truly exceptional: 30g of High-Quality Protein: Perfect for post-workout recovery, satisfying hunger between meals, or boosting the protein content of coffee/recipes. 1g Sugar & 5g Carbs: This low-carb, low-sugar profile makes it ideal for nearly any diet, including keto and low-glycemic plans. 160 Calories: A great way to add significant protein without excessive calories. Verdict & Best Uses I always keep a case of these shakes stocked. They are a true time-saver for fast breakfast additions, quick muscle fuel after the gym, or a guilt-free late-night snack. If you are struggling to find a convenient, affordable, and high-protein option that actually tastes good, look no further. This product is a staple.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025

recommand products