Pay in installments of $112.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 17 - Aug 22
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Carbonic Anhydrase XII His Tag Protein, MouseProduct Specification Species Mouse Antigen Carbonic Anhydrase XII Synonyms CA12; Carbonate dehydratase XII; carbonic anhydrase 12; Carbonic Anhydrase XII; carbonic anhydrase XIICAXII; carbonic dehydratase; CA XII; EC 4. 2. 1. 1; FLJ20151; HsT18816; Tumor antigen HOM RCC 3. 1. 3 Accession Q8CI85 Amino Acid Sequence Ala25 Ser301, with C terminal 8*His
Product Specification
| Species | Mouse |
| Antigen | Carbonic Anhydrase XII |
| Synonyms | CA12; Carbonate dehydratase XII; carbonic anhydrase 12; Carbonic Anhydrase XII; carbonic anhydrase XIICAXII; carbonic dehydratase; CA-XII; EC 4.2.1.1; FLJ20151; HsT18816; Tumor antigen HOM-RCC-3.1.3 |
| Accession | Q8CI85 |
| Amino Acid Sequence | Ala25-Ser301, with C-terminal 8*His APLNGSKWTYVGPAGEKNWSKKYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHSVRLNLNSDMYIQGLQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYPDFSTASDKSEGLAVLAVLIEIGSANPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPREMINNFRQVQKFDERLVYISFRQGLLTDTGLSGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 35-45kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Türeci , Sahin U, Vollmar E, Siemer S, Gottert E, Seitz G, et al. Human carbonic anhydrase XII: cDNA cloning, expression, and chromosomal localization of a carbonic anhydrase gene that is overexpressed in some renal cell cancers. Proc Natl Acad Sci U S A. 1998;95(13):7608-7613. |
Background
Carbonic anhydrases (CAs) are zinc metalloenzymes that catalyze the reversible hydration of CO2 to bicarbonate and protons and are therefore involved in vital physiological processes. CA XII is a membrane isozyme that is upregulated in several tumor types. CA XII is crucial for the regulation of the intracellular pH and thus for the maintenance of cell function and survival. Additionally, the enzyme contributes to the acidification of the tumor microenvironment, which in turn promotes tumor invasion and migration.CA IX and CA XII contribute to the adaptation of malignant cells to hypoxia and acidosis through the regulation of intracellular and extracellular pH. High CA IX expression is found in the kidney, lung, colon, breast, cervix, ovary, brain, and few other tumors, while CA XII is overexpressed in the kidney, gastric, colorectal, breast, and brain tumors.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy