SKU: 27552435815

R-Spondin 1(21-146) Protein, Human

Sale price$140.40 Regular price$156.00
Save 10%

Pay in installments of $39.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

R-Spondin 1(21-146) Protein, HumanProduct Specification Species Human Antigen R Spondin 1 Synonyms RSPO1,CRISTIN3,FLJ40906,RP11 566C13. 1,R spondin 1 Accession Q2MKA7 1 Amino Acid Sequence Ser21 Ala146, with C terminal 8*His SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAGGGSHHHHHHHH Expression System HEK293 Molecular Weight 17 25kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Human
Antigen R-Spondin 1
Synonyms RSPO1,CRISTIN3,FLJ40906,RP11-566C13.1,R-spondin-1
Accession Q2MKA7-1
Amino Acid Sequence

Ser21-Ala146, with C-terminal 8*His SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

17-25kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

The R-Spondin proteins comprise a family of secreted proteins, known for their important roles in cell proliferation, differentiation and death, by inducing the Wnt pathway. Several studies have demonstrated the importance of RSPOs in regulation of a number of tissue-specific processes, namely: bone formation, skeletal muscle tissue development, proliferation of pancreatic β-cells and intestinal stem cells and even cancer. RSPO1 stands out among RSPOs molecules with respect to its potential therapeutic use, especially in the Regenerative Medicine field,due to its mitogenic activity in stem cells. Here, we generated a recombinant human RSPO1 (rhRSPO1) using the HEK293 cell line, obtaining a purified, characterized and biologically active protein product to be used in Cell Therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27552435815

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mahlon Everhart
Fort Morgan, US
★★★★★ 5
Wonderful
Format: Kindle
The amount of detail in this book is so interesting and the specifics of so much theoretical ideas revolving around true ideas makes it so fun to read. The writer does a great job and describing every situation enough where you get the point but not too much to try to bore you . The book is very easy to follow, keeps you on your toes, was pretty funny to me, and truthfully just a great book for anyone!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
J
Verified Purchase
John Haldane
Los Angeles, US
★★★★★ 4
Read it in 2 days
Format: Paperback
This is science based science fiction. How refreshing to read science without turning the story into horror. Without a plethora of characters, it is easy to remember who is who. The story moves along well enough that I wanted to keep going. It us a p age turner in many respects. All this said, there were too many crises suddenly resolved like some Star Trek episode from 1966. It reached the point where I said to myself, "OK, this doesn't matter. Move along, nothing to see here." There was good humor, some surprising twists, and enough involvement with characters that I didn't want to put it down. As science fiction goes, it was good like pulp stories go. It wasn't like Ursula LeGuin or Robert Heinlein but I would probably pick up the next book he writes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
H
Verified Purchase
Hanay21
Phoenix, US
★★★★★ 5
A book worth rereading
Format: Hardcover
This was a book club pick. Honestly, I wouldn't have chosen to read this myself, but I'm glad that I did. I would have missed out on an incredible story. I've been reading a lot of thriller and fantasy books lately, that I forgot how much I enjoy sci-fi. This brought it back for me. There's a lot of science-heavy discussions in the book and I loved it! When I got to a subject or term I didn't know, I would go online and learn more about it. I feel that Grace is a dork like me because he wouldn't curse. He had little anecdotes he uses in place of swearing. Something I definitely do myself! A lot of the book is the MMC talking to himself. Surprisingly, it worked. There's so much humor that it kept the story going. There was not a lull. Usually I dislike info-dumping as an introduction to get all the background story told, but I didn't mind it at all. Maybe I'm being biased because I love science talk. **SPOILERS AHEAD** What makes the whole plot engaging is the fact that the plot doesn't seem too fantastical. It's something that could happen. There's a lot of ethics and morals involved in determining what should be done. I would hate to be in a position where I have to chose what's best for everyone. That's why Stratt is a necessary character. I hated some of her decisions and how she operated, but you need someone who's focused on the general welfare of humanity. I would be too focused on myself, my family, etc. As much as it hurts to admit, I'm selfish (and a coward) like Grace. I wouldn't want to die. But was it right for Stratt to force him on the mission? This could also be taken religiously. If God has a plan and things happen for a reason, is it our right to deter what's going to happen? God wiped out the world many times because of humanity's sins, what if this was God's doing? So many questions and debates on right vs wrong, ethics vs morals, and religion vs humanity made for a incredible book club discussion. I love how this book ended. I wish I could continue reading about Rocky and Grace's adventures, it's that fascinating. However, I think Grace staying on Erid was the best outcome. If the roles were reversed, I don't think Rocky would have the same welcome. I feel that those in charge would have dissected and kept Rocky hostage, all in the name of science. Just as the Astrophage were first introduced, the first things the scientists did was poke and probe. Essentially torturing the Astrophage to see what makes them tick. I think Rocky would have the same fate. Oh, and my favorite part is the relationship between Rocky and Grace. I cried so many times when I was reading. Scared that something bad was going to happen to either of them. Especially in the scene where Rocky busted out of his tunnel to save Grace. I got upset and told the book that 'if Rocky dies, I swear, this is the worst book ever!' And the scene where Rocky learns about radiation poisoning. How he slowly becomes aware of what happened to his crew, his friends. I was a mess. This book is definitely one that I could go back and reread. I did watch the movie afterwards. There's a lot of differences to adapt the story to screen, but it was okay. They got the humor down pat, but I didn't get the direness of the whole situation nor the special bond that both MCs had.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
K
Verified Purchase
Kindle Customer
West Palm Beach, US
★★★★★ 5
Excellent story
Format: Kindle
This book is worth your time. It is a great introduction to a variety of scientific disciplines without insulting the reader. It also respects and understands humanity, engineering, history and political science. Then it lays that foundation to tell the story of a unique friendship of two beings with mutual goals who have to communicate and problem solve together. Along the way, you can really contrast how Grace and Rocky do it, vice the Hail Mary team did it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
G
Verified Purchase
Gilligan
Los Angeles, US
★★★★★ 5
A Brilliant, Emotional, and Unforgettable Sci-Fi Adventure
Format: Paperback
Project Hail Mary by Andy Weir is one of those rare novels that delivers everything you could want from science fiction: gripping suspense, fascinating science, humor, heart, and a genuinely moving story about survival and friendship. The novel follows Ryland Grace, a middle school science teacher who wakes up alone on a spacecraft with no memory of who he is or why he’s there. As his memories slowly return, the stakes become clear: humanity is facing extinction, and he may be the only person who can stop it. The mystery unfolds at a perfect pace, blending high tension with moments of discovery that keep you turning the pages. What makes this book stand out is how seamlessly it combines hard science with accessibility. Like the author’s earlier work, the scientific details feel authentic and well researched, but they never overwhelm the story. Instead, the problem-solving becomes the engine of the plot. Each obstacle feels real, and the solutions are both clever and satisfying. The biggest surprise—and the emotional core of the novel—is the relationship that develops during the mission. Without giving anything away, it adds warmth, humor, and depth that elevate the story far beyond a typical survival thriller. By the end, the novel becomes less about science and more about courage, trust, and the willingness to sacrifice for others. The pacing is excellent throughout, with a balance of suspense, humor, and heartfelt moments. If there’s a small drawback, it’s that some plot developments feel a bit convenient. But the strong characters and emotional payoff more than make up for it. Overall, this is a must-read for fans of science fiction, space exploration, and anyone who enjoys smart, character-driven storytelling. It’s thrilling, funny, deeply human, and surprisingly emotional. I finished it feeling both entertained and uplifted. Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026

recommand products