SKU: 28672499787

Human CD28, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD28, His tagProduct Specification Species Human Synonyms TP44 Accession P10747 Amino Acid Sequence Protein sequence(P10747, Asn19 Pro152, with C 10*His) NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 8 kDa Actual: 30 47 kDa Purity >95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance

Product Specification


Species Human
Synonyms TP44
Accession P10747
Amino Acid Sequence

Protein sequence(P10747, Asn19-Pro152, with C-10*His) NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:16.8 kDa Actual:30-47 kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD28 (Cluster of Differentiation 28) is one of the proteins expressed on T cells that provide co-stimulatory signals required for T cell activation and survival. T cell stimulation through CD28 in addition to the T-cell receptor (TCR) can provide a potent signal for the production of various interleukins (IL-6 in particular). CD28 is the receptor for CD80 (B7.1) and CD86 (B7.2) proteins. CD28 is the only B7 receptor constitutively expressed on naive T cells. CD28 was also identified on bone marrow stromal cells, plasma cells, neutrophils and eosinophils. As a homodimer of two chains with Ig domains binds B7 molecules on APCs and it can promotes T cells proliferation and differentiation, stimulates production of growth factors and induces the expression of anti-apoptotic proteins.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 28672499787

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sabrina
Charlottesville, US
★★★★★ 5
Love it
Color: Pawty
This was perfect for my boys 5th birthday. It’s cute and he loves it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 16, 2025
A
Verified Purchase
Alejandro Castillo
Natrona Heights, US
★★★★★ 5
Great Launcher.
Style: 1.7" Ball
It launches balls impressively far, which keeps my pup happily running and burning off energy. No longer having to bend down to pick up slobbery tennis balls! is a huge win! It’s lightweight, easy to use, and surprisingly durable. Highly recommend for anyone with an energetic pup and a desire to keep fetch going without the strain! Just note that it is for smaller sized tennis balls.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 12, 2025
C
Verified Purchase
CakeorDeath
Omaha, US
★★★★★ 5
Excellent product, but keep it away from chewers.
Style: 2.5" Ball
This is a very strong and effective launcher and could have lasted a very long time had my 9 month old not chewed the ball claw end off. I will buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2026
C
Verified Purchase
Cranberry
Lake Worth, US
★★★★★ 5
Our Dog Loves This Ball Thrower So Much
Style: 2.5" Ball
Works excellent for dogs that like to fetch! Our family dog loves this toy. He will bark and jump as soon as he sees us pick it up. The dog next door to us gets excited when he sees us play with our dog with this dog ball thrower. Its that good for dogs who love to fetch and run. Perfect for the young and elderly to play fetch with a pet dog. If you have back or shoulder problems works very well. You don't have to bend down and pick up a slobbery ball. Nope you use this to pick up, grip up and grab the ball. Wish every dog could have this ball thrower in their lives. It has changed the way we play fetch with our dog.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2025
J
Verified Purchase
Jean H.
Whiting, US
★★★★★ 4
Good Pet Ball Launcher
Style: 2.5" Ball
I bought to throw balls for my Aussie. He does not like to tennis ball that came with it and chewed it up in less than one play time. The launcher seems to be of good quality and works well. We bought different balls made for launchers that work well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 24, 2025

recommand products