SKU: 29033837416

Human IL-1beta, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 6 - Aug 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-1beta, His tagProduct Specification Species Human Synonyms Catabolin Accession P01584 Amino Acid Sequence Protein sequence (P01584, Ala117 Ser269, with C 10*His) APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 19 kDa Observed MW: 20 kDa Purity 90% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Catabolin
Accession P01584
Amino Acid Sequence

Protein sequence (P01584, Ala117-Ser269, with C-10*His) APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19 kDa Observed MW: 20 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin-1 beta (IL-1β) is a proinflammatory cytokine that is mainly produced by monocytes and activated macrophages as a proprotein. Inflammatory responses are mediated by IL-1β in T cells, natural killer cells (NK cells) and B cells. It induces the production of pro-inflammatory cytokines (IL-2, IL-3, IL-6) as well as interferons. Furthermore, IL-1β modulates the secretion of cytokines by various subsets of human DCs.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29033837416

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
Van Wanggaard Racine Wi
New York, US
★★★★★ 5
Very well made!
Size: Small, Color: Bunny
This toy is great! Two squeakers and made to last even my Airedale. He doesn’t want to put it down.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2026
J
Verified Purchase
JHI
New York, US
★★★★★ 5
Won't last forever, but my dog loves it
Size: X-Large, Color: Giraffe
My dog, a 90 lb black lab, LOVES these toys. He does prefer the raccoon to the giraffe, but he likes them both a lot. I originally got the raccoon on clearance at Target when looking for a long toy he could play with while he was in a cone recovering from surgery (he likes to be able to hold toys between his front paws and mouth/chew on them, so none of our regular squeaky footballs were long enough for that). He loved it so much I had to find more, so I found this giraffe from the same line of toys. He's a destroyer and he has been able to put a few holes in these toys if I'm not watching him, but they're pretty easy to sew if they need patching. My mother-in-law's dog came over and made a hole so big that the squeakers and lining all came out, but I sewed it back up and it's almost as good as new. They definitely won't last forever, but they have lasted longer than other soft toys we've had in the past.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2017
N
Verified Purchase
Nancy Dodson-Houck
Draper, US
★★★★★ 5
My dogs favorite
Size: Small, Color: Bunny
I need this toy! It is my dogs favorite. She even takes this on walks. Ive replaced this on 3 times because it was “eaten” by my daughters dog. I keep it put up and Georgia constantly goes to the spot I keep it and is expecting me to give it to her. Please restock soon
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
E
Verified Purchase
Ema
Chelsea, US
★★★★★ 4
My doggo's go-to toy!
It's not the most durable of toys (she's on her third in five years) but I will buy her as many as she needs because she is OBSESSED with it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 5, 2024
A
Verified Purchase
Amazon Customer
Pawtucket, US
★★★★★ 5
Nice
Size: Small, Color: Bunny, Size: Small, Color: Bunny
Cute, dog loves it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026

recommand products