SKU: 29231495680

Apo-SAA2 His Tag Protein, Human

Sale price$585.00 Regular price$650.00
Save 10%

Pay in installments of $162.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Apo-SAA2 His Tag Protein, HumanProduct Specification Species Human Synonyms Apo SAA2, SAA, SAA2, Serum Amyloid A2 Accession P0DJI9 Amino Acid Sequence MHHHHHHDDDDKRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY Expression System E. coli Molecular Weight 13. 2 kDa Purity 95% by SDS PAGE and RP HPLC Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 25mM Arg, 20mM Tris

Product Specification


Species Human
Synonyms Apo-SAA2, SAA, SAA2, Serum Amyloid A2
Accession P0DJI9
Amino Acid Sequence MHHHHHHDDDDKRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
Expression System E.coli
Molecular Weight 13.2 kDa
Purity

>95% by SDS-PAGE and RP-HPLC

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 25mM Arg, 20mM Tris-HCl, 150mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

SAA is similar to CRP and is used to evaluate the acute reaction process. SAA is a sensitive parameter. It begins to increase after about 8 hours of inflammatory reaction, and the time to exceed the upper limit of the reference range is earlier than that of CRP. However, the difference between the median value of CRP in normal people and the upper limit of the reference range is about 10 times. In SAA, it is only 5 times. For mild infections, for example, many viral infections, elevated SAA is more common than CRP. In infectious diseases, the absolute increase of SAA is higher than that of CRP, so the determination of SAA, especially for "normal" and minor acute reactions, should provide better differentiation. SAA is usually elevated in patients with a cold about 2pm 3, but CRP is also elevated in patients with less than 1pm 2. In viral infection cases, elevated concentrations of SAA and CRP were found in patients with adenovirus infection. The response patterns of SAA and CRP are parallel in the recovery phase of acute infection, which is suitable for both bacterial and viral infections. SAA was not elevated in lupus erythematosus and ulcerative colitis. The increase of SAA in the stage of malignant tumor metastasis is usually higher than that in the organ stage of the tumor. SAA detection is a very sensitive index for transplant rejection. In a study of kidney transplant recipients, 97% of the tests for rejection were based on elevated SAA. In the detection of irreversible transplant rejection, the average concentration was 690 ±29mg/L, while the correlation level in patients with reversible rejection was 271 ±31mg/L. A chronic increase in SAA concentration in patients with rheumatoid arthritis, tuberculosis or leprosy is a prerequisite for the synthesis of AA- starch fibers, which is also used to diagnose secondary amyloidosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29231495680

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
donald m hebert sr.
Louisville, US
★★★★★ 5
My wife uses it more
Style: dog ball launcher
My dog loves it she can run father
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026
O
Verified Purchase
owtem
Belleville, US
★★★★★ 1
Mid at best
Style: dog ball launcher
It’s mid at best. Requires a little trick to get it to go forward and not just fly up in the air., it’s also not telescoping. It just comes apart into two pieces.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
D
Verified Purchase
Delter Dawn
Chelsea, US
★★★★★ 5
Better than expected
Style: dog ball launcher
Works GREAT !!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
A
Verified Purchase
Ange
Omaha, US
★★★★★ 1
Wouldn’t buy again
Style: dog ball launcher
Compared to the namebrand thrower this one sucks. It just throws the ball way up in the air.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
D
Verified Purchase
David O.
Battle Creek, US
★★★★★ 5
Good size, Durable, Easy to use
My dog doesn't really play with balls that much. But she does love a laser which I was hoping the light in this ball might mimic for her. And it does. She loves this ball. And the winter months when the days are short finding games we can play at the park is critical for her well-being. The ball came in an attractive packaging with a charger and charged quickly. It's a simple push of the button on the light to activate it. It will turn off on its own but light back up when it's moved, which is handy. The light has a soft glow to it which is pleasant to be around. The ball is easy to see at night and has a good bounce to it as well. My dog chewed on it for quite a bit and it's held up really well, so I will say it's pretty durable and chewable. The weight in the ball is nice and it's an easy throw. My only suggestion is to make sure that you have the light piece locked in place first. I have thrown it where the ball and the light went in two different directions. And that was my fault. Lol We have had some great fun with this ball at the park. For the short winter days it's a perfect addition to your pet's play routine. We love it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025

recommand products