SKU: 2944776604

uPAR/CD87 His Tag Protein, Mouse

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

uPAR/CD87 His Tag Protein, MouseProduct Specification Species Mouse Antigen uPAR CD87 Synonyms Monocyte activation antigen Mo3, U PAR, uPAR, CD8, Urokinase Type Plasminogen Activator (UPA) Receptor, URKR, U Plasminogen Activator Receptor Form 2, CD87 Antigen, Plasminogen Activator, Urokinase Receptor, MO3 Accession P35456 Amino Acid Sequence Leu24 Gly298, with C terminal 8*His

Product Specification


Species Mouse
Antigen uPAR/CD87
Synonyms Monocyte activation antigen Mo3, U-PAR, uPAR, CD8, Urokinase-Type Plasminogen Activator (UPA) Receptor, URKR, U-Plasminogen Activator Receptor Form 2, CD87 Antigen, Plasminogen Activator, Urokinase Receptor, MO3
Accession P35456
Amino Acid Sequence

Leu24-Gly298, with C-terminal 8*His LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPTGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

45-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Desmedt, S. et al. (2017) Crit. Rev. Clin. Lab. Sci. 54:117.2.Smith, H. et al. (2010) Nat Rev Mol Cell Biol 11:23.

Background

Urokinase plasminogen activator surface receptor (U-PAR) is also known as PLAUR, Monocyte activation antigen Mo3, CD antigen CD87.The urokinase-type Plasminogen Activator (uPA) is one of two activators that converts the extracellular zymogen plasminogen to plasmin, a serine protease that is involved in a variety of normal and pathological processes that require cell migration and/or tissue destruction. uPA is synthesized and released from cells as a single-chain (sc) pro-enzyme with limited enzymatic activity and is converted to an active two-chain (tc) disulfide-linked active enzyme by plasmin and other specific proteinases. Both the scuPA and tcuPA bind with high-affinity to the cell surface via the glycosyl phosphatidylinositol-linked receptor uPAR which serves to localize the uPA proteolytic activity. The enzymatic activity of scuPA has also been shown to be enhanced by binding to uPAR. Independent of their proteolytic activity, the uPA/uPAR interaction also initiates signal transduction responses resulting in activation of protein tyrosine kinases, gene expression, cell adhesion, and chemotaxis. uPAR can interact with integrins to suppress normal integrin adhesive function and promote adhesion to vitronectin through a high affinity vitronectin binding site on uPAR. The uPA/uPAR interaction initiates signal transduction responses resulting in activation of protein tyrosine kinases, gene expression, cell adhesion, and chemotaxis. uPAR can interact with integrins to suppress normal integrin adhesive function and promote adhesion to vitronectin through a high affinity vitronectin binding site on uPAR. uPAR is considered as a biomarker in many inflammatory diseases including cancer, cardiovascular diseases, chronic kidney diseases and diabetes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2944776604

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
HD Rider
West Palm Beach, US
★★★★★ 5
Great product
Size: 4.5", Style: Open
Strong grip
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
B
Verified Purchase
BLACKMAMBASHOP
Grantham, US
★★★★★ 5
Classy gift for men.
I gifted this beautiful leather organizer to my BF last year for Xmas. He loved, it is functional and storage his belongings at reach and looks very nice. Very good quality and affordable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 8, 2024
M
Verified Purchase
Mary
Massapequa, US
★★★★★ 5
Little pricey, but worth it
Very nice product. Creates a clean look on my fiances night stand rather than having everything all over the place. I like the little compartment with the door, its nice for putting things out of sight. The coin compartment is nice as well. The curve of the bottom makes it easy to get the coins out. I do think its a little pricey for what it is, but i still feel it was worth it to organize the clutter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 17, 2020
I
Verified Purchase
I. Gonzalez
Whiting, US
★★★★★ 5
Very nice product to keep things organized
Great product to keep your items organized when coming home or in your office. The item is very well built and has a nice elegant look and feel to it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2023
C
Verified Purchase
Carmen J Santora
Houston, US
★★★★★ 4
Nice touch
Allows for some organization, and looks nice. Pretty sturdy, and I have not had any issues with it, I was a little smaller than I hoped.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 28, 2020

recommand products