SKU: 29780196265

Biotinylated B7-H3/CD276 His&Avi Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated B7-H3/CD276 His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms B7 H3, CD276; B7H3, B7 H3, CD276 antigen, CD276 molecule, CD276, B7H34Ig B7 H3, B7 H3B7 homolog 3, Costimulatory molecule Accession Q5ZPR3 2 Amino Acid Sequence Leu29 Pro245, with C terminal 10*His&Avi tag

Product Specification


Species Human
Synonyms B7-H3, CD276;B7H3, B7-H3, CD276 antigen, CD276 molecule, CD276, B7H34Ig-B7-H3, B7-H3B7 homolog 3, Costimulatory molecule
Accession Q5ZPR3-2
Amino Acid Sequence

Leu29-Pro245, with C-terminal 10*His&Avi tag LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPHHHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

38-48kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Liu J. et al. (2021) Targeting B7-H3 via chimeric antigen receptor T cells and bispecific killer cell engagers augments antitumor response of cytotoxic lymphocytes. J Hematol Oncol. 14(1): 21.

Background

B7-h3 (B7 homolog 3 protein), also known as CD276, is an important immune checkpoint molecule in the B7-CD28 family. It is a type I transmembrane glycoprotein consisting of 316 amino acids and contains a putative 28AA signal peptide, a 217AA extracellular region composed of immunoglobulin constant (IgC) and variable (IgV) structures, a transmembrane region, and a 45-amino acid cytoplasmic domain. B7-H3 is a T cell co-suppressor molecule with partial co-stimulatory function. B7-H3 can effectively inhibit the function of T cells and NK cells, and also play a role in bone development. The expression of B7-H3 is low in normal tissues and is found in a variety of malignant tumors, which is closely related to the growth, metastasis, recurrence and poor prognosis of malignant tumors. B7-H3 can down-regulate T-assisted type 1 mediated immune response, inhibit CD4+T cell activation and inhibit cytokine production, and thus may play a role in promoting immune escape of cancer cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29780196265

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
SickboySD
Draper, US
★★★★★ 5
Replacement parts
Size: 19 Pcs for eufy L60/ L50 Series
Good replacement parts pack. This will last you a while.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
L
Verified Purchase
Luis Estuardo Lima
Lowell, US
★★★★★ 5
It si the right fit
Size: 19 Pcs for eufy L60/ L50 Series
It si working perfectly fine it fit like a glove
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
S
Verified Purchase
S. McCarty
Grantham, US
★★★★★ 5
Excellent fit and value - recommended buy
Size: 3+12+12+2+1 pack
I rarely write reviews, but I'm so impressed by the fit and quality of this set that I made an exception. I'd been running my eufy 11S without brushes, and have been cleaning and reusing the filters for a while now and finally decided to buy replacements. The kit came packed well with everything in order and no damage. I replaced all of the worn parts and installed the brushes and did a test run - everything worked great. I expected some fitment issues because I've seen that with other kits, but I had no issues. The fact that you get multiples of almost everything is icing on the cake. Oh, and I wasn't paid or given anything in exchange for this review, as much as that's worth now, haha. I can recommend getting this kit for your robot vacuum, if it's the right set for your model.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2025
L
Verified Purchase
LGN
Fort Morgan, US
★★★★★ 5
Good option for an aftermarket replacement solution.
Size: 3+12+12+2+1 pack
I've been very happy with this product. I think it is a good price point for what is included. Everything was a directly compatible and everything fit as you would expect. The filter quality is good and since there are plenty in the kit I find I change the filters more often which is probably a good thing. I recommed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2025
D
Verified Purchase
deb
Chelsea, US
★★★★★ 5
Eufy Brushes wear out with daily use
Size: 4 Pack
These brushes help the Eufy continue to run efficiently. I have 2 dogs and run 2 Eufies daily. It is surprising how much sand, dust, gravel and hair gets vacuumed. My furniture isn't as dusty and my floor doesn't need mopping as often.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 7, 2026

recommand products