SKU: 30308891586

GPA33 His Tag Protein, Human

Sale price$288.90 Regular price$321.00
Save 10%

Pay in installments of $80.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GPA33 His Tag Protein, HumanProduct Specification Species Human Antigen GAP33 Synonyms Glycoprotein A33, Cell surface A33 antigen Accession Q99795 Amino Acid Sequence Ile22 Val235, with C terminal 8* His ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVGGGSHHHHHHHH Expression System HEK293 Molecular Weight 34

Product Specification


Species Human
Antigen GAP33
Synonyms Glycoprotein A33, Cell surface A33 antigen
Accession Q99795
Amino Acid Sequence

Ile22-Val235, with C-terminal 8* His ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNVGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 34-39kDa(Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Sakamoto J., Kojima H., Kato J. Hamashima H., Suzuki H. Organ-specific expression of the intestinal epithelium-related antigen A33, a cell surface target for antibody-based imaging and treatment in gastrointestinal cancer. Cancer Chemother Pharmacol. 2000;46 Suppl: S27–32.2.Ackerman M.E., Chalouni C., Schmidt M.M., Raman V.V., Ritter G., Old L.J., Mellman I., Wittrup K.D. A33 antigen displays persistent surface expression. Cancer Immunol Immunother. 2008;57(7):1017–27.

Background

GpA33 is a cell-surface differentiation antigen that belongs to the immunoglobulin superfamily. The GpA33 encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. GpA33 antigen is a cell surface glycoprotein of the small intestine and colonic epithelium with homology to tight junction-associated proteins of the immunoglobulin superfamily, including CAR and JAM. Immunohistochemical study of normal tissues identified the large and small intestinal mucosa as the principal site of A33 expression. GpA33 is found in 95% of primary and metastatic colorectal cancers, with uniform expression throughout the tumors in most cases. Because of its presence only in the intestine or in tumors in the intestine, the gpA33 has been evaluated as a target for the detection and radioimmunotherapy of colon cancer tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 30308891586

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Brande B
Phoenix, US
★★★★★ 5
Toughest dog toy we've ever owned! Jasper approved!
Style: Elk, Style: Elk
If you are the owner of a "power chewer" who usually turns standard plushies into a snowstorm of stuffing in under five minutes, the HOUND2O Elk Stuffed Animal is the heavy-duty solution you’ve been looking for. This isn't just a toy; it’s a rugged piece of outdoor-grade gear that manages to stay "plush" while being nearly indestructible. Here is why this elk is the gold standard for aggressive chewers. The "Ballistic" Build The secret to its toughness lies in the materials. Unlike cheap fleece or thin polyester, the HOUND2O Elk is engineered for extreme durability. Ballistic Nylon Shell: The body is wrapped in high-denier ballistic nylon—the same type of material used in tactical gear. It’s incredibly resistant to punctures and tears from sharp canine teeth. Reinforced TPR Accents: The "antlers" and specific high-wear points are reinforced with Thermoplastic Rubber (TPR). This gives your dog a satisfying, grippy texture to gnaw on without compromising the toy’s structural integrity. Extreme Stitching: The seams are double-stitched and recessed, making it nearly impossible for a dog to find a "weak spot" to start a rip. Built for Adventure: This toy is marketed for "outdoor adventures," and it truly lives up to that branding: Water-Resistant & Buoyant: Unlike most stuffed animals that become soggy, heavy sponges, this elk is water-resistant and it floats. It’s the perfect companion for a trip to the lake or a game of fetch in the pool. Easy to Clean: Because the material is so dense, mud and slobber don't soak in deeply. A quick rinse with a hose or a wipe-down with soap and water makes it look brand new after a day in the dirt. High Visibility: The vibrant colors and distinct shape make it easy to spot in tall grass or murky water, so you won't lose it during a long-range game of fetch. Engaging (But Tough) Squeaker For many aggressive chewers, the goal is to "silence" the squeaker as fast as possible. Protected Internal Squeaker: The squeaker is buried deep within the ballistic layers, making it much harder for a dog to pinpoint and puncture. It provides that high-value auditory feedback that keeps dogs engaged without being an easy "kill point" for the toy. Performance at a Glance Durability - Ballistic nylon and TPR are a "power chewer" dream. Versatility - Floats, easy to clean, and works indoors/outdoors. Engagement - Mixed textures (nylon + rubber) keep dogs interested. Value - Outlasts 10 standard plush toys combined. The HOUND2O Elk is a 10/10 for any pet parent tired of throwing away shredded toys. It is incredibly tough, intelligently designed, and built to withstand the "ruffest" play. While no toy is truly 100% indestructible for every single dog, this is as close as a plush-style toy can possibly get. If your dog loves the "thrill of the hunt," try hiding this elk in some tall grass or bushes outside. Its tough shell can handle the brush, and it’s a great way to provide mental stimulation alongside a heavy chewing session!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026
M
Verified Purchase
Melissa Withers
Boise, US
★★★★★ 2
Not as durable as it looks
Style: Snake
Our half pittbull and half american bulldog tore this apart in 5min.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
A
Amazon Customer
Boise, US
★★★★★ 5
Good looking toy that has held up well
Style: Coyote, Style: Coyote
Very durable toy that our little dog especially loves. It's the perfect size for a small dog and she doesn't destroy toys anyway so it's been great. It does feel very durable though and would take our chewer a little while to get to it as well. I'm not sure it looks like a coyote but the dogs don't seem to mind. It's an attractive toy that looks great and is constructed well so it's not like a slobbery mess when left out. Good value for the money and would make a great gift because it looks higher quality than most toys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
S
StarReviewer
Boise, US
★★★★★ 1
May be ballistic nylon, but the seams are flimsy.
Style: Gator, Style: Gator
I really wanted my pup to like this toy because it looks great and feels solid at first. The design is fun, the material seems tough, and it definitely gives the impression that it can handle some rough play. Unfortunately, that didn’t turn out to be the case at all. After just about 5 minutes of play, the top seam split open and stuffing started coming out. This wasn’t even extreme chewing, just normal play, and it failed almost immediately. As you can see in the photos, the tear happened right along the top seam, which is exactly where you’d expect a toy to be reinforced. Once it opened up, the toy was essentially done. For something marketed as ballistic nylon, this was really disappointing. It might be fine for very gentle dogs, but if your dog has even moderate chewing habits, this likely won’t last. Based on my experience, I wouldn’t recommend it. especially at 19.99 which is the price at time of my review, I feel it does not offer good value for money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
A
Amazon Customer
Natrona Heights, US
★★★★★ 5
A Surprisingly Tough Favorite for All Four of My Dogs
Style: Armadillo, Style: Armadillo
I wasn’t sure what to expect from the Hound 2.0 stuffed armadillo toy, but it has been a total hit in my house. Neither the dogs nor I have managed to find the squeaker yet—so it’s either missing or extremely well hidden—but honestly, the dogs don’t seem to care at all. They love this thing. I have four dogs ranging from a 22 lb Boston Terrier to an 85 lb pitbull, plus two medium Blue Heelers in between, and this toy has been thoroughly tested by every size and play style. I was a little unsure whether they’d like the harder “shell” portion of the armadillo, but they actually love it. It gives the toy a unique texture and makes it feel more durable. Before this, I knew nothing about the Hound 2.0 brand, but I’m a fan now. My little Boston Terrier is notorious for ripping every toy he touches, and this armadillo has stood up to him like a champ. The tag said it was made for outdoor play, wrestling, and chewing—and that’s absolutely true. I haven’t taken it outside yet, but inside it has survived rough play from all four dogs and still looks brand new. I also love that each toy in this line is a different animal with the hard parts in different places. It makes them feel unique instead of just the same toy in different shapes. I’ll definitely be buying more of these. If you have a pup—big, small, or anywhere in between—I’d recommend giving this toy a try. It’s been a winner in my multi‑dog home.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026

recommand products