SKU: 30457285366

SIRP-α/CD172A Fc Chimera Protein, Mouse

Sale price$225.90 Regular price$251.00
Save 10%

Pay in installments of $62.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 24 - Jul 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SIRP-α/CD172A Fc Chimera Protein, MouseProduct Specification Species Mouse Synonyms BIT, MFR, MYD1, P84, PTPNS1,SHP substrate 1, SHPS1, SHPS1, CD172A Accession P97797 1 Amino Acid Sequence Lys32 Asn373, with C terminal Human IgG Fc

Product Specification


Species Mouse
Synonyms BIT, MFR, MYD1, P84, PTPNS1,SHP substrate 1, SHPS1, SHPS1, CD172A
Accession P97797-1
Amino Acid Sequence

Lys32-Asn373, with C-terminal Human IgG Fc KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWNIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 95-110kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Barclay, A.N. & M.H. Brown (2006) Nat. Rev. Immunol. 6:457. 2. vanBeek, E.M. et al. (2005) J. Immunol. 175:7781. 3. Liu, Y. et al. (2005) J. Biol. Chem. 280:36132. 4. Kharitonenkov, A. et al. (1997) Nature 386:181.

Background

Signal regulatory protein alpha (SIRP alpha, designated CD172a), also called SHPS-1 (SHP substrate 1) and previously, MyD-1 (Myeloid/Dendritic-1), is a monomeric ~90 kDa type I transmembrane glycoprotein that belongs to the SIRP/SHPS (CD172) family of the immunoglobulin superfamily. SIRPs are paired receptors, with similar extracellular domains but differing C-termini and functions. The 503 amino acid (aa) human SIRP alpha contains a 342 aa extracellular domain (ECD), with one V-type, and two C1 type Ig domains, and three potential N glycosylation sites. It has a 110 aa cytoplasmic sequence with ITIM motifs that recruit tyrosine phosphatases SHP-1 and SHP-2 when phosphorylated.SIRP alpha is expressed mainly on myeloid cells, including macrophages, neutrophils, dendritic and Langerhans cells. It is also found on neurons, smooth muscle and endothelial cells. SIRP alpha shows adhesion to the ubiquitous CD47/IAP (integrin associated protein), while SIRP gamma binds more weakly and SIRP alpha 1 does not bind at all.Mouse and human SIRP alpha -CD47 binding only cross-reacts for specific polymorphisms and influences engraftment of xenotransplanted stem cells. SIRP alpha engagement generally produces a negative regulatory signal. Low SIRP alpha recognition of CD47, which occurs on aged erythrocytes or platelets or xenogenic cells, promotes clearance of CD47low cells from circulation. SIRP alpha recognition of surfactants SP-A and SP-D in the lung can inhibit alveolar macrophage cytokine production.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 30457285366

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Elizabeth Delgado
Draper, US
★★★★★ 3
Great Entertainment, Short Battery Life
Color: Classic Blue
This is the first interactive ball I've found that my dog hasn't managed to destroy, which is impressive on its own. The ball keeps him entertained for long periods, and he loves chasing, nudging, and following it around the house. The material feels durable and has held up well to regular play. The one button operation is convenient, and the ball is easy to recharge and clean. My biggest complaint is the battery life. On a full charge, it only seems to run for about 10 minutes before needing to be recharged again. Because of that, I find myself charging it frequently. Even with the shorter runtime, it's been one of the more engaging and durable interactive toys we've tried. Overall, a fun and sturdy toy that keeps dogs occupied, but be prepared for frequent charging.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
A
Amazon Customer
Draper, US
★★★★★ 5
Fun Dog Toy
Color: Classic Blue
This toy has been a lot of fun for our dogs. One of my dogs absolutely loves balls and is perfectly content to just carry this around in his mouth. The outer shell feels like a firm foam material. It is durable while still being lightweight enough for the dogs to enjoy. The ball screws together, but it is designed well enough that you are not constantly worried about it coming apart. You have to intentionally press and twist it to open it, so normal dog play has not caused any issues. Inside is the motorized component, which is easy to turn on and recharge. It offers a few different vibration modes, which keeps things interesting. The reactions from our dogs have been hilarious. One dog is convinced the ball might be plotting against him and keeps a suspicious distance. Another dog loves it so much that he holds it in his mouth while it vibrates, making his entire head shake. Our third dog plays with it exactly as intended, chasing it around and interacting with it normally. The motor has enough power to make the ball bounce, roll, and move unpredictably across the floor, which keeps the dogs engaged. It has been a great addition to our toy collection and provides a different kind of enrichment than a standard ball. Overall, the dogs really enjoy it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
S
Shannon
Lake Worth, US
★★★★★ 4
A fun toy
Color: Classic Blue
Our Malamute loves this ball. He likes to carry it around with him and let it will out of his grasp and pick it back up. The outer ball it tough and durable, and so far it has held up well during play. It does bounces more than rolls I expected a little more movement across the floor in a more rolling fashion... like those weasel balls from the 90s, but tends to hop and bounce in place. It does works best on hard floor where it has enough contact to move around and keep the dog engaged. To charge you have to unscrew the ball in half to access the motor unit, and there is grease on the motor, so be careful when opening it and handling the internal piece. It is not difficult, but it is a little more complicated than a simple plug-in charging port. The button on is also super hard to press. I you have to really squeeze it and even use a tool to turn it on. It has 2 modes though it is so hard to press I am not sure which mode I actually turn on. It so far has been a fun toy for our young dog and has lasted our extreme chewer (only supervised play) I would recommend if it went on sale.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
B
Ben G
New York, US
★★★★★ 5
Works well on hardwood, and my dog is just a coward
Color: Classic Blue
This ball works really well on hardwood floors, rolling and moving around just like it's supposed to, though it struggles on carpet where the resistance seems to bog it down. I expected my dog to be thrilled by it, but instead he was afraid of the thing. In fairness, he's a big scaredy-cat by nature, so that says more about him than the toy. The ball itself feels very tough and well made. If he would actually work up the courage to chew on it, I suspect it would hold up extremely well, and I don't think he'd be able to pop it open on his own either. So it's a solid, durable toy that's earned my confidence, even if it hasn't yet earned my dog's.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
R
Rocky Mountain High
Massapequa, US
★★★★★ 5
Keeps puppy busy .. and busy .. and busy
Color: Classic Blue, Color: Classic Blue
My young Shih Tzu is all about "magic" balls. He seems to know what is in the box before it is even opened. The product page says this ball is not meant for small dogs. Well, my Shih Tzu puppy can't read. He is positively obsessed with HIS newest "smart" toy. Thankfully, this ball came with a partial charge so Bodhi could begin playing immediately. This toy is an improvement over Bodhi's previous chargeable balls with unpredictable movements. I really like that the power button is on the outside since it makes it easier than taking the halves apart every time. The toy functions on every surface (so far) and it is reasonably quiet. This item is also waterproof so it can be rinsed off easily after use. Fantastic interactive toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026

recommand products