SKU: 31495232370

Human TNF-β Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TNF-β Protein, His TagProduct Specification Species Human Synonyms Lymphotoxin alpha, LT alpha, TNF beta, Tumor necrosis factor ligand superfamily member 1, LTA, TNFB, TNFSF1 Accession P01374 Amino Acid Sequence Protein sequence (P01374, Leu35 Leu205, with C His Tag) LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms Lymphotoxin-alpha, LT-alpha, TNF-beta, Tumor necrosis factor ligand superfamily member 1, LTA, TNFB, TNFSF1
Accession P01374
Amino Acid Sequence

Protein sequence (P01374, Leu35-Leu205, with C-His Tag) LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Expression System HEK293
Molecular Weight Predicted MW: 20.3 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNF-beta, also known as Lymphotoxin-alpha (LTα), is a cytokine belonging to the tumor necrosis factor (TNF) superfamily. Its primary function involves the development and organization of secondary lymphoid organs, such as lymph nodes and spleen, during embryogenesis. In adulthood, TNF-beta is a key mediator in the maintenance of the lymphoid architecture and the initiation of inflammatory responses against pathogens. It exists in two forms: a soluble homotrimer that signals through TNF receptors 1 and 2, and a membrane-bound heterotrimer with LTβ, which signals through the LTβ receptor. Dysregulation of TNF-beta is implicated in autoimmune and chronic inflammatory diseases, making it a significant therapeutic target.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 31495232370

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Texgurl
San Leandro, US
★★★★★ 4
Does the trick
Bought it with urea cream for my senior dad who was diabetes. Careful with it, it will tear
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
A
Verified Purchase
Amazon Customer
Grantham, US
★★★★★ 5
The really work!
Bought these or a friend with severely dry cracked feet. The change was significant and immediate. They wore them around the house for a day and that night they could already feel the difference.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
L
Lina
Grantham, US
★★★★★ 5
Fabulously bizarre and effective
These silicone socks have to be the strangest item I have ever ordered from Amazon. However strange they are, I was pleasantly surprised with them. My order came with two pairs, and I took one pair out to wash before use. I laughed at handling them then because they were a cross between hospital socks and leftover mannequin skin…trippy. The socks dried fast, so I put on foot lotion and put the socks on. The socks are beige skin tones that cover the entire foot up to the ankle, basically booties. The silicone is very soft and makes putting on and taking off the socks easy. They are also surprisingly easy to walk around in because the bottoms have grips, again, like hospital socks. I walked on tile, hardwood, and carpet with no slipping. The booties also stayed in place with no issues. I was concerned my feet would sweat, but that didn't happen. I was able to wear them for 3 hours without sweaty feet. When I took them off, my feet were a lot more soft than before or if I had used regular socks. For reference, my feet are not terrible, but the skin around my toes is dry and peeling from my picking(gross, I know). The socks I got are a size large, which worried me because they are big, but the site said for my shoe size (9) that's what I should order, and they were right. They are the perfect size and stretchy for room. I can't believe how cool and well-thought-out these socks are, on top of working. Honestly, these are among the top 20 favorite items I've ordered from Amazon. They may look incredibly strange, and they are, but they work wonders.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2025
A
Verified Purchase
Amazon Customer
Birmingham, US
★★★★★ 3
Not well made
I have used these for 2 weeks now and one of them has a hole in the sole... I won't ever buy them again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 15, 2025
B
Verified Purchase
Bella
Houston, US
★★★★★ 5
super cute
Size: 4-10, Color: Avocado (Coral)
So comfy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 8, 2025

recommand products