SKU: 32353965755

Human FDX1 Protein, His Tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FDX1 Protein, His TagProduct Specification Species Human Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin 1, Hepatoredoxin, ADX Accession P10109 Amino Acid Sequence Protein sequence (P10109, Ser61 Ser184, with C His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Expression System E. coli Molecular Weight Predicted MW: 15. 4 kDa Observed MW: 13 kDa Purity 90% by SDS PAGE

Product Specification


Species Human
Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin, ADX
Accession P10109
Amino Acid Sequence

Protein sequence (P10109, Ser61-Ser184, with C-His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Expression System E.coli
Molecular Weight Predicted MW: 15.4 kDa Observed MW: 13 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

FDX1, or ferredoxin 1, is an essential mitochondrial iron-sulfur protein that functions as a critical electron carrier in several fundamental biochemical pathways. Primarily located in the mitochondrial matrix, it shuttles electrons from NADPH via ferredoxin reductase to key enzymes involved in steroidogenesis, heme biosynthesis, and iron-sulfur cluster biogenesis. By facilitating these electron transfer reactions, FDX1 plays a central role in cellular metabolism, energy production, and the synthesis of vital biomolecules. Recent research has also highlighted its significant role in regulating copper-dependent cell death (cuproptosis), making it a protein of growing interest in cancer biology and therapeutic development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32353965755

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
S. Rose
Chelsea, US
★★★★★ 1
WARNING - EXTREMELY SHARP AREAS
Color: Yellow Nylon Corn on the Cob, Color: Yellow Nylon Corn on the Cob
UPDATE: The 2nd one I ordered was exactly the same with the sharp parts in the same areas as the first one. I cannot stress enough that a few points are sharp enough to cut or badly scratch. So if you’re planning on putting some food on it so your pup can lick, this is not the product you want! This could still scratch or cut the gums if used as a chew toy too though. I was thinking about sanding the sharp points but then I have no idea if that exposes any chemicals somehow? Really wanted this to work out! I took this corn on the cob toy out of the plastic to wash it and before I even got to the sink I realized there were several areas that are super sharp. A few sharp enough that could cut or badly scratch! It was sealed in a plastic bag and shows no signs of being used so this defect must happen at the manufactures level. I added a video showing how easily it snags a cotton ball, cotton pad and even a beanie. Please thoroughly check your item before giving it to your pup! I was so excited to put some smashed banana on this thing and give it to my guy and thank god I checked it first! I’m going to return it and see if a 2nd one is any better and I’ll update if it is or isn’t. Also, the super sharp spots were very hard to photograph which is why I added the video.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2021
J
Verified Purchase
Jean Kanzler
San Leandro, US
★★★★★ 4
Nice toy
Color: Red Nylon Yellow Hotdog
It is cool, tough and hard. Just wish it was larger bc my dog is 80 pounds. It won’t fall apart in a day and made in the USA!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 14, 2024
A
Verified Purchase
Amazon Customer
West Palm Beach, US
★★★★★ 5
good purchase
Color: Red Nylon Yellow Hotdog
This thing is great for hi anxiety dogs and dogs that ned to have something to do or to chew. It will take them a while to get through to it. I was told that it was indestructible but I knew if there was a dog that could do it, it would be mine, and she did. But it took her some time. But she loves it and it keeps her busy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 24, 2025
M
Verified Purchase
Mary Ann
Boise, US
★★★★★ 5
Cute and durable!
Color: Red, Color: Red
My dog absolutely loves this toy! I'm not sure why people are complaining it's too hard, it's a nylon dog chew toy, it's supposed to be hard. I love the little holes in the lattice top I can stuff with treats. It keeps my very (VERY) active dog busy for a long time. I would definitely recommend this if you have a power chewer. It's also super cute, I just love to see him tote around a piece of pie.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2021
K
Verified Purchase
Kindle Customer
Pawtucket, US
★★★★★ 5
Durable, Long-Lasting, and a Total Hit!
I’m so impressed with the Bam-Bone Braid Stick Dog Toy in Hickory! I bought three—one for each of my dogs—and they’ve all been a huge hit. My dogs absolutely love them and stay entertained for hours. What really stands out is how well these hold up. My Frenchie is a super tough chewer, but these toys have proven to be very durable and long-lasting. It’s rare to find something she doesn't destroy quickly, but these definitely passed the test. I’ll definitely be buying more in the future. Highly recommend for anyone looking for a sturdy, engaging chew toy that dogs truly enjoy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026

recommand products