SKU: 32920842045

Human PRL, His tag

Sale price$173.25 Regular price$192.50
Save 10%

Pay in installments of $48.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PRL, His tagProduct Specification Species Human Synonyms Prolactin, Lactotropin Accession P01236 Amino Acid Sequence Protein sequence(P01236, Leu29 Cys227, with C 10*His) LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 24. 5kDa Actual: 25,28kDa

Product Specification


Species Human
Synonyms Prolactin, Lactotropin
Accession P01236
Amino Acid Sequence

Protein sequence(P01236, Leu29-Cys227, with C-10*His)
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 24.5kDa Actual:25,28kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Prolactin (PRL), also known as lactotropin, is a protein best known for its role in enabling mammals to produce milk. Prolactin is secreted from the pituitary gland in response to eating, mating, estrogen treatment, ovulation and nursing. It is secreted heavily in pulses in between these events. Prolactin plays an essential role in metabolism, regulation of the immune system and pancreatic development. Prolactin levels may be checked as part of a sex hormone workup, as elevated prolactin secretion can suppress the secretion of follicle stimulating hormone and gonadotropin-releasing hormone, leading to hypogonadism and sometimes causing erectile dysfunction. Prolactin levels may be of some use in distinguishing epileptic seizures from psychogenic non-epileptic seizures. The serum prolactin level usually rises following an epileptic seizure.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32920842045

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Holley Noel
Charlottesville, US
★★★★★ 5
Great buy!
We utilized this text during my Group Psychology course in my masters program. I felt it was very informative and is referred to highly by several of my colleagues. I had sold the text back to my campus book store a few years ago, but have decided I will benefit from having a copy available to me over my development as a professional. The information within this text, specifically the theories described by Yalom, are also incorporated into the state licensure exam, so it is a good reference to have when studying for this exam as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 8, 2012
Z
Verified Purchase
Zack
Draper, US
★★★★★ 5
Excellent definitive group process textbook - not dry or verbose
Yalom certainly conveys his knowledge, research, and experience clearly in an organized, interesting, and engaging way that makes this textbook easy reading, but not at all simplistic. Had to stop and "chew" on material often to absorb. A must for anyone who has the responsibility of facilitating a therapy group. Not for support group-related work, especially. This is process group 100%.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 5, 2019
M
Verified Purchase
Michael P. Hipsley
Los Angeles, US
★★★★★ 5
The Most Clear and Accessible (Not to Mention Funny) Treatment of the Trinity I Have Ever Encountered
Format: Paperback
The Trinity may be the most difficult Doctrine of the Church to understand and it is even more difficult to explain clearly; yet it is also central and essential to the Christian Faith. This makes it very difficult for those of us in ministry who want to teach about the Nature of God with accuracy, clarity, and care. More often than not, discussions of God’s Triune nature involve analogies of water, apples, hats, and other such symbols that never seem to really help anyone’s understanding and serve only to muddy the theological waters. Stephen Bullivant’s concise, fair-minded, humorous, and incredibly accessible work is truly a breath of fresh air. It has brought much needed relief from bad analogies and incredible clarity to a difficult topic. I will even go so far as to say it has re-shaped both my thinking about and teaching of the Trinity. What I love most about this book is that I can recommend it to anyone. The clarity of thought with which Bullivant writes, and the ease with which he uses pop-culture and humor to illuminate complex ideas make this a rare book on theology that provides the reader with both the erudition of a scholar and the art a communicator. I have been teaching from this book at our church since I read it last Spring and I can attest from the feedback that I have gotten that it has been a game-changer on the topic of the Trinity for many people here. Quite a few have told me that the way Bullivant explains the Trinity has brought them clarity one this the Doctrine for the first time in their Christian experience. I cannot recommend this book highly enough for anyone in ministry that is looking for a way to communicate a very difficult theological topic with clarity, humor, humility, and care.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 12, 2015
S
Verified Purchase
Stephen M.
Battle Creek, US
★★★★★ 5
A Clear, Readable, and Necessary Contribution
Format: Paperback
This is a clear, readable, and necessary book. The Trinity is the central mystery of the Christian faith, but it can be difficult to articulate in a simple and coherent way. As one who regularly teaches the topic in the Catholic high school setting, I appreciated the very accessible approach that the author takes. Anyone who struggles with the basic meaning of the doctrine would benefit from this text, as would those who are tasked with explaining it to others. From the very first page of the book, the author presents the doctrine of the Trinity through three basic statements: 1. There is only one God. 2. The Father, the Son, and the Holy Spirit is each God. 3. The Father, the Son, and the Holy Spirit are not the same. Besides a very good opening chapter on the ability to speak about God at all, the entire book is basically an unpacking of why the Church came to believe in these three statements and the problems (aka heresies) that arise when any one of the three is denied. Over the course of the book, the reader will become familiar with many of the key biblical texts underlying the doctrine of the Trinity and the early theologians who defended it. While this is not primarily a work of doctrinal history, the arguments are almost entirely based on the thought of these fourth and fifth century theologians. Two points are worth noting, though neither was a "deal breaker" for me: First, be ready for lots of references to popular culture. I was surprised to see mentions of everything from Wayne's World and Borat to the song Achy Breaky Heart and the Three Amigos. These are no doubt great examples from the author's experience, as university teacher, in connecting the subject matter to his student audience. But in almost every instance I found myself drawn away from the topic at hand and in some cases I was left pondering the usefulness of the gratuitous reference itself. Luckily, I got almost every single one--until a late reference to the British TV series Father Ted forced me to look it up on Google. Second, I'm not sure if this book is still in such an early printing that it hasn't been physically typeset yet, but my edition looked as though an inkjet printer produced it. In an age of Retina display screens, it was a bit odd being disappointed in the quality of actual printed text. Overall, I highly recommend the book. I've just ordered the author's previous book from Paulist Press and look forward to his future works.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2015
I
Verified Purchase
ILOVEMYKINDLE
Louisville, US
★★★★★ 4
This book is good if you wish to know the heresies of the ...
Format: Kindle
This book is good if you wish to know the heresies of the Trinity. It does not cover the inner working relationships of the Trinity.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2016

recommand products