SKU: 33882524337

Human papillomavirus type 16 E7

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7Product Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Expression System E. coli Molecular Weight Predicted MW: 11. 0 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered

Product Specification


Species Human papillomavirus type 16
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Expression System E.coli
Molecular Weight Predicted MW: 11.0 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins. HPV E7 plays a major role in HPV-induced malignancy, perturbing cell cycle regulation, and driving cell proliferation. Major targets of cancer-causing HPV E7 proteins are the pRB family of tumor suppressors, which E7 targets for proteasome-mediated degradation and whose interaction is promoted through an acidic patch, downstream of the LXCXE motif in E7, that is subject to phosphorylation by casein kinase II (CKII).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33882524337

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Lake Worth, US
★★★★★ 3
no thank you
Color: Blue, Size: Queen Size Set of 2
while they look great, they are not soft. I can not sleep with them. Woke with a headache.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
R
Verified Purchase
Rochelle Johnson
Lake Worth, US
★★★★★ 5
Loved the pillows
Color: Blue, Size: Queen Size Set of 2
I don’t get paid for reviews so if you want a real one here ya go …. These pillows are great in my opinion. They came vacuum sealed and popped right up “ big and fluffy” immediately, as in big enough I wasn’t sure they would fit in my pillow cases. I used them last night and even though they are full, big and fluffy they still smashed down to a proper size when I laid my head down. First night in a long time I did wake up with a headache. I was extremely happy with these pillows. Now cooling ….I didn’t really find a difference from a reg pillow but, that again just could be me. Hope this helps
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
M
Verified Purchase
MIRZA IRFAN BAIG
Belleville, US
★★★★★ 5
Heavenly Sleep Upgrade – DIORIS Pillows Are a Dream Come True!
I’ve finally found the perfect pillows! The DIORIS Queen Pillows Set of 2 has completely transformed my sleep experience. From the moment I laid my head down, I felt like I was at a luxury hotel — but right in my own bedroom! These pillows strike the ideal balance between softness and support. The premium down alternative filling cradles the head and neck gently, yet offers just the right amount of firmness. Whether I sleep on my side, back, or stomach, these pillows adapt perfectly and keep me comfortable all night long. The slow-rebound, breathable fiberfill is a game changer. It stays cool, supports proper posture, and even helps reduce neck pain — something I’ve struggled with for years. I wake up feeling refreshed and ache-free, which is priceless.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025
D
Verified Purchase
Daliana guerra
Port Orchard, US
★★★★★ 5
Wonderful
Size: Cooling Queen, Size: Cooling Queen
I absolutely love these pillows From the very first night, I could feel the difference. They are incredibly comfortable, soft, and still provide great support for my neck and head. Plus, the modern design makes my bed look so much cleaner and more elegant. The fabric feels high quality, and the pillows keep their shape really well. I genuinely feel like I’m sleeping better since I started using them. Great value for the price, and I would definitely buy them again. Highly recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
J
Verified Purchase
Jan Vyse
Cuba, US
★★★★★ 5
Great pillow
Size: Queen(Pack of 2)
Very comfortable pillows, medium softness with support
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products