SKU: 33953486449

SLAMF7/CRACC/CD319 Fc Chimera Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 7 - Aug 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SLAMF7/CRACC/CD319 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms SLAMF7, CRACC, CD319, CS1, CRACC, 19A, FOAP 12 Accession Q9NQ25 Amino Acid Sequence Ser23 Met226, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms SLAMF7, CRACC, CD319, CS1, CRACC, 19A, FOAP-12
Accession Q9NQ25
Amino Acid Sequence

Ser23-Met226, with C-terminal Human IgG1 Fc SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

60-72kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Lee J K. et al. (2004) Molecular and functional characterization of a CS1 (CRACC) splice variant expressed in human NK cells that does not contain immunoreceptor tyrosine-based switch motifs. Eur J Immunol. 34(10): 2791-2799.

2、Tassi I. et al. (2005) The cytotoxicity receptor CRACC (CS-1) recruits EAT-2 and activates the PI3K and phospholipase Cgamma signaling pathways in human NK cells. J Immunol. 175(12): 7996-8002.

3、Lee J K. et al. (2007) CS1 (CRACC, CD319) induces proliferation and autocrine cytokine expression on human B lymphocytes. J Immunol. 179(7): 4672-4678.

4、Cruz-Munoz M E. et al. (2009) Influence of CRACC, a SLAM family receptor coupled to the adaptor EAT-2, on natural killer cell function. Nat Immunol. 10(3): 297-305.

Background

SLAM family member 7 (SLAMF7) is also known as CD2-like receptor-activating cytotoxic cells (CRACC), Membrane protein FOAP-12, CD antigen CD319, Novel Ly9, Protein 19A, which is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. Mature mouse CRACC consists of a 202 amino acid (aa) extracellular domain (ECD) with one Ig-like V-set domain and one Ig-like C2-set domain, a 21 aa transmembrane segment, and an 88 aa cytoplasmic domain with two immunoreceptor tyrosine-based switch motifs ITSMs. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33953486449

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Draper, US
★★★★★ 5
Go to sunscreen for toddler
Size: 3 Fl Oz (Pack of 1)
We love the sunscreen for our toddler (and ourselves) so much! We've tried so many sunscreens out there and we love this one for our 18-month-old and we use it every day. It's awesome that it's roll on so we can apply it easily to our wiggly son and then simply rub in. Our whole family has a very sensitive skin and the sunscreen is not caused any problems. It's gentle and effective. It does have a white cast but all you have to do is rub it in for about 10 to 15 seconds and then you're good to go! We love that it's water resistant because we can't keep our toddler out of the water. I'm going to buy more for Grandma and Grandpa's house and to have in our diaper bag as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 11, 2024
L
Verified Purchase
Laura
Grantham, US
★★★★★ 4
Slightly messy but easy to use and fun for toddlers
Size: 3 Fl Oz (Pack of 1)
My 3 year old loves this sun screen! The roller ball makes it easy for him to have a bit of independence when it comes to applying. He can roll it on and then we can rub it in together. My only complaint is it is a bit watery which has caused it to leak a little around the cap and sometimes drip as you put it on. For me though it’s a minor inconvenience if it gets my toddler to put on his sunscreen without too much of a battle
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 24, 2024
M
Verified Purchase
Melissa
Massapequa, US
★★★★★ 5
Roll on sunscreen is a game changer!
Size: 3 Fl Oz (Pack of 1)
This will be my second summer using this sunscreen for my children and I love it! I can apply it even when they are squirmy. They have also started to ask to apply it themselves. Even when my kiddos apply too much and resemble Casper the Ghost - it rubs into their skin fairly easily. I appreciate that there isn't a scent to the sunscreen and it provides great coverage. Both my boys have sensitive skin and this sunscreen has never irritated their skin. I also like that there are just two main ingredients: zinc and titanium oxide unlike other sunscreens in the market that contain many more ingredients. Easy to pop in your beach bag or in a school backpack. The cover remains tight and I've never had the sunscreen accidentally leak. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 12, 2024
S
Verified Purchase
S.C.
Belleville, US
★★★★★ 5
Works well
Size: 3 Fl Oz (Pack of 1)
This is the best SPF for my three-year-old, I use a blush brush to evenly spread it on her face and arms. It works really well, but it does leave the skin a bit white.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
J
Verified Purchase
Jen
Houston, US
★★★★★ 5
Perfect Little Sun Care Kit — Great for Travel!
Style: Original, Style: Original
I love this Sun Bum Road Tripper set! The travel‑sized products are perfect for tossing into my beach bag or carry‑on, and everything smells amazing. It has all the essentials you need for a day in the sun without taking up a ton of space. The quality is exactly what you expect from Sun Bum — gentle, effective, and reliable. This is such a convenient little kit for trips, beach days, or keeping in the car. Definitely a must‑have for anyone who loves being outdoors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026

recommand products