SKU: 34674896475

Human SAA-1

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human SAA-1Product Specification Species Human Synonyms Serum amyloid A 1, SAA1 Accession P0DJI8 Amino Acid Sequence Protein sequence (P0DJI8, Arg19 Tyr122) RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY Expression System E. coli Molecular Weight Predicted MW: 11. 7 kDa Observed MW: 11. 7 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a

Product Specification


Species Human
Synonyms Serum amyloid A-1, SAA1
Accession P0DJI8
Amino Acid Sequence

Protein sequence (P0DJI8, Arg19-Tyr122) RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

Expression System E.coli
Molecular Weight Predicted MW: 11.7 kDa Observed MW: 11.7 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Serum amyloid A1 (SAA1) is a protein that in humans is encoded by the SAA1 gene. SAA1 is a major acute-phase protein mainly produced by hepatocytes in response to infection, tissue injury and malignancy. When released into blood circulation, SAA1 is present as an apolipoprotein associated with high-density lipoprotein (HDL). SAA1 is a major precursor of amyloid A (AA), the deposit of which leads to inflammatory amyloidosis. SAA1 has been a clinical indicator and reliable biomarker for inflammatory diseases, chronic metabolic disorders and late-stage malignancy. SAA1 has been extensively studied for its binding to HDL, with results suggesting a role in lipid metabolism. SAA1 has been associated with tumor pathogenesis, and its gene polymorphism is a contributing factor to certain types of malignant tumors. SAA1 has also been shown to affect the tumor microenvironment and contribute to tumor cell metastasis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 34674896475

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
jc
Battle Creek, US
★★★★★ 4
The basic set-up is relatively easy which was a big plus for me......
First let me start off by saying that I am not an audiophile. So, this review will not get into the weeds of the more complex settings this receiver is capable of. For example, the Dirac room measuring option. No way was I attempting to mess with that. Especially, after reading that some reviewers who actually have experience with Dirac found it could be confusing/difficult to set up. Besides I come from a previous Onkyo the TX-SR607 which had the AccuEQ Room Calibration similar to this receiver, so I used that instead with no issues. As far as hooking up the speakers it's pretty straight forward. If you have banana plugs, use them, seriously. I originally planned on using banana plugs but in order to save time I decided against that. But I wish I had taken the extra time to go with bananas because trying to thread the speaker wire into the speaker terminals is tedious, there not much room between the terminals and even me with my skinny fingers struggled a bit. Wish Onkyo designed their terminals side by side, but I think only Denon does that. Anyway, after all the speakers were connected (I'm currently using a 5.1.2 setup) and I connected my tv, Blu-ray player, CD player, etc., etc., I ran the AccuEQ Room Calibration, and I was good to go. I did change the some of the settings like speaker volume that AccuEQ has set but nothing major. I have noticed that I need to turn the volume up much higher on this Onkyo than on my previous one. What I mean by that is that on my previous Onkyo I would set the volume indicator at around 30-35 tops for movies. With this one it's more like 40-45, maybe how the volume is measured is different on this one. The sound is excellent for movies and music I have no complaints there. I have only tried a few of features so far like Airplay but will dig deeper into the manual (I downloaded from the internet) as time goes by. I will say as far as build quality is concerned it's not bad, but IMO my old Onkyo, a 2009 model, had the look and feel of a more expensive receiver. But it's what's inside that matters most so hopefully this one last as long as my previous Onkyo.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2024
J
Verified Purchase
JOKER
Waukegan, US
★★★★★ 1
Sound unexpectantly blasted for no reason. It malfunctioned!
I spent hours between installation and set up! I had to return it. I turned on NET (network) to play Sirius Xm and the volume was low but after a few minutes the sound turned all the way up to maximum completely on its own? This happened at least two more times. I contacted ONKYO and was told it is clearly defective and that their is no solution to correct the problem, and that I should return it immediately! I purchased the newer model and am pleased with its performance! It’s unfortunate because the first one that had the issue with the sound really played nice, but having sound change its volume so suddenly to its full capacity was not what I expected, nor felt comfortable enough to keep as I said I was told to return it, which I did! My advice here would be to purchase the newer model, which seems to be much more stable in its performance, and the quality is excellent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 29, 2025
B
Verified Purchase
Bossman
Natrona Heights, US
★★★★★ 5
Absolutely Love This Receiver
The Onkyo TX‑NR7100 has completely transformed my home theater. The sound quality is rich, detailed, and powerful, and the 9.2‑channel setup gives movies and music a level of immersion I didn’t realize I was missing. Dirac Live right out of the box is a huge win — the room correction made an immediate, noticeable improvement. Setup was smooth, the interface is clean, and everything from streaming to switching inputs feels fast and reliable. It also plays perfectly with the rest of my system, and the THX certification really shows in how cinematic everything sounds. I absolutely love this receiver. It’s one of those upgrades that makes you wonder why you didn’t do it sooner.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
J
Verified Purchase
James Tepper
Chelsea, US
★★★★★ 5
Incredible 9.2 Surround receiver at an unbeatable price.
I may return at a future date to give a more complete review, but others that are much more knowledgeable about audio equipment than I have already done so. For me, the Onkyo (Onkyo TX-NR7100 9.2-Channel 8K/4K Network A/V Receiver) replaced a much older (2001) TX DS787 5.1 100 W Surround receiver that listed new for around $1050. I probably didn't pay quite that much but certainly something near $900. It was great for its time, perhaps even advanced with THX, Dolby, and other listening modes. But it didn't have: HDMI inputs or outputs, any BlueTooth capability, no hard wired or WiFi connectivity or basically any operating or connection modes that most all modern receivers have. This turned into a big problem with modern LED/LCD/OLED TVs, Alexa and other now common devices. I bought my new Onkyo TX-NR7100 from Amazon for $625. Other retailers (e.g.Best Buy) advertise it for up to $1200, so Amazon's price is outstanding. Set up was far more complicated (for me) than any previous receiver that I ever owned, mostly because there were a very large number of back panel input and output jacks, to and from the TV, as well as speaker outputs for 9.2 surround. Suffice it to say that once everything was connected properly (I made a few mistakes along the way), I was completely thrilled. The On Screen Display, completely accessible either from the front panel or the remote was far superior to anything I had ever seen before. Literally every operating parameter is accessible to the user. And I used most of them. It is also completely WiFi ready so my 150 Gbit home Wifi network lets it connect wirelessly and stream music error free. BlueTooth is also another way to connect almost any device to it for audio and audio/video playback if you connect the digital connections to and from a modern TV. It also speaks and listens to Alexa, although I must confess that I haven't played around with that much yet. This is already much longer than I had intended, so let it suffice to say that the Onkyo TX-NR7100 is an absolutely incredible receiver for an incredible price. I'd give it 8 stars if I could. JM TEPPER
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2024
B
Verified Purchase
Brian M.
Lexington, US
★★★★★ 5
Sounds great.
Just received my Onkyo TX-NR 7100, watched a few YouTube videos before it arrived, so set up was easy. Ran accuEQ, I am getting new front speakers so I’ll wait to run Dirac. After accuEQ, I still had to make a few adjustments, to the speaker levels and especially the sub. It set my subwoofer way too low. As of right now having no problems with Bluetooth. I’ve only listened to music so far, can’t wait to watch a movie. For now I have a 5.1.2. System, getting new fronts, the Klipsch r51-m’s will go to the rear surround and Klipsch r41-m’s will be my height speakers in a 5.1.4 system. So far loving this avr. Update 2: Just calibrated with Dirac for the 6th time. They tell you if you sit in a recliner, reclined measure with it reclined. Well I measured with the chair in its upright position. It makes a huge difference I hear the surrounds much better. Btw I listen to all channel stereo, I know audiophiles say it sucks, however I listened to 2 channel stereo for 20 years, when there was nothing else. I didn’t buy a 9 channel avr to listen to 2 channel stereo. Like Randy the cheap audio man says “ audiophiles aren’t always right. If it sounds good to you, that’s all that matters.” So try calibrating in the upright position, or if you sit on a stationary chair or couch, try positioning the mic slightly forward of your listening position. It makes a huge difference. Hope this helps, enjoy. Update: Ok bought Klipsch rp-600m speakers for the front with 52c center. 51m surrounds, 41m rear heights. Polk owm3 front heights. Why Polk? Lighter easy to hang and as height speakers they are only there for atmos. Ran Dirac live, the application does what it would take several hours to make it sound like it does, if I even could get it to sound so good. Apple TV 4K with my Hisense U8K. The google tv interface is ok, but Apple TV is faster and easier. The Onkyo 7100 is a gem, runs pretty warm but I have it out in the open. If you are going to put in a cabinet I suggest a fan. Very happy with the whole system.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2025

recommand products