Pay in installments of $60.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
B7-H7/HHLA2 His Tag Protein, HumanProduct Specification Species Human Synonyms B7 H7, HHLA2, B7 Homolog 7 Accession Q9UM44 Amino Acid Sequence Ile23 Asn344, with C terminal 8*His
Product Specification
| Species | Human |
| Synonyms | B7-H7, HHLA2, B7 Homolog 7 |
| Accession | Q9UM44 |
| Amino Acid Sequence | Ile23-Asn344, with C-terminal 8*His IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHNGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 51-67kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Zhu Y. et al. (2013) B7-H5 costimulates human T cells via CD28H. Nat Commun. 4: 2043. 2、Dong Z. et al. (2018) EGFR may participate in immune evasion through regulation of B7-H5 expression in non-small cell lung carcinoma. Mol Med Rep. 18: 3769-3779. |
Background
Human endogenous retrovirus-H long terminal repeat-associating protein 2 (HHLA2; also known as B7H7 or B7H5) is the only member of the B7 protein family found in humans. HHLA2 cannot be found in mice and is mainly expressed in human breast, lung, thyroid, melanoma, pancreas, ovary, liver, bladder, colon, prostate, kidney and esophagus cancer cells, activated myeloid cells, monocyte-derived macrophages and dendritic cells. In addition, HHLA2 interacts with the co-receptor CD28H to stimulate T cell proliferation, differentiation and the production of cytokines, including IFN-γ, IL-2 and IL-10. In terms of cancer, higher expression levels of HHLA2 were previously reported to be associated with poorer prognoses or higher degrees of tumour invasion in lung carcinoma, hepatocellular carcinoma and prostate cancer.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 5 reviews
Sort
Product Reviews
★★★★★ 5
Good Buy
Fill Material: Down Alternative, Size: Queen/Standard Size
Very well done and easy to use. I love being able to adjust the filling, and the ability to clean it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
★★★★★ 5
excellent medium consistency pillow
Fill Material: Down Alternative, Size: Queen/Standard Size
Pillow is medium firmness with extremely uniform compression consistency. i have a very particular desire for something not too hard or too soft and this is the sweet spot... more stuffing is provided so you can add (or remove) some if needed to get what you like...i didnt need to but liked to have that option. also the feel of the cover is nice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
★★★★★ 5
Immediately yes
Fill Material: Down Alternative, Size: King Size
I’m 50 and peri has been kicking my butt lately, so temperature management of my head (as that is the only thing effected by my hot flashes) has been an ever pressing project that I’ve been managing for the last 3-4 years. Hot sleeping has always been one of my curses, so adding perimenopause to the mix has been my own special hell. But Dyson fans, keeping the bedroom window cracked, and lots of all cotton gauze blankets have been imperative for me in the night. Pillows have always been pillowing, they just get warm and flipping them all night long is just finding the least hot version. I even keep 2 pillow choices on the bed while I sleep, and 2 more an arm’s length away on the chest at the bottom of the bed. Silk pillowcases are great for my hair and skin but they don’t keep cool. THESE PILLOWS, complete with the Beckham cooling pillowcases are chef's kiss. They feel like they’ve been in the fridge. Literally. Now do they stay that way, of course not. But they’re cool enough for me to fall asleep. And if I wake, I use the other side. And if I keep another on standby, I am literally finding the cool side of the pillow all night long. I’m not exaggerating either. These pillows are cool WITH the cooling pillowcases. You can’t use a pillow protector though, even if it’s cotton. It will ruin the effect. And you must use the cooling pillowcases. Do both, and you won’t be disappointed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2026
★★★★★ 1
Terrible update to a good pillow
Fill Material: Down Alternative, Size: Queen/Standard Size
Purchased this as I was looking to replace tbe previous Beckham hotel pillows I had purchased before. When I saw "newer model available" I ordered it. Wish I had just ordered the same ones as before. First off this was only 1 pillow, not the 2 pack. Since I was only replacing 1 pillow I decided to use it. Huge mistake, my neck has been sore almost everyday. The support of this pillow is terrible, even with trying to added and remove some fill to adjust it. Nothing seems to make a difference. Avoid it and order a different model. Wish I had sent it back for a refund when I got it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
★★★★★ 5
Best Pillow e
Fill Material: Down Alternative, Size: Queen/Standard Size
I’ve been using this pillow for 3 months now. It is, hands down, the BEST pillow I’ve ever had. It’s soft and supportive at the same time. As I noted, I’ve been using it for 3 months and it has maintained its loft unlike some of the other types of pillow I’ve tried. Well worth the price and I highly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026