SKU: 35098167538

FST/Follistatin His Tag Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FST/Follistatin His Tag Protein, HumanProduct Specification Species Human Antigen FST Follistatin Synonyms FS, FSP Accession P19883 1 Amino Acid Sequence Gly30 Trp344, with C terminal 8*His

Product Specification


Species Human
Antigen FST/Follistatin
Synonyms FS, FSP
Accession P19883-1
Amino Acid Sequence

Gly30-Trp344, with C-terminal 8*His GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEWGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 35-45kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Paul T Fullerton Jr, Diana Monsivais. Follistatin is critical for mouse uterine receptivity and decidualization. Proc Natl Acad Sci U S A. 2017 Jun 13;114(24): E4772-E4781. Epub 2017 May 30.

Background

Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. There are two major isoforms of FST, FST288, which is anchored to the cell surface by interactions with heparin sulfate proteoglycans, and FST315, which is the predominant form found in circulation. In humans, aberrant expression of FST and activins are implicated in infertility; dysregulation of FST, activins, and inhibins was reported in women with impending abortion, recurrent miscarriage, hypertensive disorders during pregnancy, and repeated implantation failure after in vitro fertilization. However, the role that FST plays in normal pregnancy remains uncertain.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35098167538

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Marie
Whiting, US
★★★★★ 5
Dialysis pillow
Size: Medium, Color: Grey
I got it from my husband when he’s taking Dialysis. I like that it doesn’t slide down the chair in his recliner. It makes it more comfortable for my husband while he’s doing dialysis.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
K
Verified Purchase
kmehor
Phoenix, US
★★★★★ 4
Decent quality
Size: Medium, Color: Grey
It’s flatter than pictured but overall quality is great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
R
Verified Purchase
Renee M.
Grantham, US
★★★★★ 5
Comfy
Size: Medium, Color: Grey
Love it, has Velcro so doesn’t shift and when I took it out of vacuum bag thought it wouldn’t be good but after 24 hours puffed up and feels like soft memory foam. Perfect for a chair I have with a lower back. A big thumbs up January 25, 2025: I change this to a 4 star, after using there are white silk like strings coming off the material onto my hair. Not sure why!!!!!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2026
A
Verified Purchase
Amazon Customer
Natrona Heights, US
★★★★★ 5
Wish The Adhesive Pad Worked With Leather
Size: Medium, Color: Grey
The pillow is comfortable but the adhesive pad on it needed to be more sticky for leather. I still give five stars because they reached out and offered to help with a full refund, and asked for pictures to help identify the problem.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2026
M
Verified Purchase
Michael Kyle.
Draper, US
★★★★★ 5
Made a great pillow better.
Had an awesome pillow but if I didn't fluff it before going to sleep my neck would hurt the next morning. Ordered this and put about 70% into a cardboard box to expand then shoved it into my pillow. Its been great 👍 put the rest in another pillow. Had no scent. My pillows are king sized.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026

recommand products