SKU: 35661447784

HBV Surface Antigen-preS2 Protein

Sale price$86.40 Regular price$96.00
Save 10%

Pay in installments of $24.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HBV Surface Antigen-preS2 ProteinProduct Specification Species HBV Synonyms Middle surface antigen; PreS2 Accession P03140 Amino Acid Sequence MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN Expression System E. coli Molecular Weight 5. 8 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 20mM PB, 50mM NaCl, pH7. 4 Reconstitution Reconstitute at less than 1

Product Specification


Species HBV
Synonyms Middle surface antigen; PreS2
Accession P03140
Amino Acid Sequence

MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN

Expression System E.coli
Molecular Weight

5.8 kDa(Reducing)

Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

20mM PB, 50mM NaCl, pH7.4

Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Hepatitis B surface antigen S2 (HBV Surface Antigen-preS2) is the smallest unit of transcriptional activator encoded by the surface gene of hepatitis B virus (HBV). It can be used as an auxiliary diagnostic reagent for hepatitis B virus infection. It exists in more than 1/3 of HBV integration units, and HBV integration units are an important factor in inducing liver cancer (HCC). HBV Surface Antigen-preS2 is also an effective regulator of apoptosis induced by tumor necrosis factor-related apoptosis-inducing ligand (TRAIL). It is involved in promoting hepatocyte apoptosis induced by TRAIL, thereby increasing the risk of malignant transformation of human hepatocellular carcinoma cell line (HepG2).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35661447784

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Heather
New York, US
★★★★★ 5
Amazing prayer guide
Format: Paperback
This book was so amazing. This book helped me rethink my praying techniques. I absolutely love this book. It’s perfect for any woman looking to improve her prayer life.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2025
A
Verified Purchase
Amazon Customer
Belleville, US
★★★★★ 5
The recommended prayers are great
Format: Paperback
Love the knowledge that I gained from reading this book. Also it has great references to go back to when needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2025
T
Verified Purchase
This worked great! I recently had major back surgery and this was perfect for hair washing!
Chelsea, US
★★★★★ 4
The truth
Format: Paperback
It’s a good read but tells how to pray against demon warfare but nowhere does it tell how you( the reader) can be delivered!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2025
E
Verified Purchase
Elisabeth Noll
Lake Worth, US
★★★★★ 5
What's the most important thing to know?
Format: Paperback
It's wonderful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
S
Verified Purchase
Shannon
Chelsea, US
★★★★★ 5
Gentle on Skin, Great Value
Color: 6pcs
Great quality and easy to use. These dermaplane razors remove peach fuzz and shape eyebrows with precision while being gentle on sensitive skin. My skin feels smoother, makeup applies better, and the 6-pack is a great value. Definitely a great purchase!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026

recommand products