SKU: 36787889729

Mycobacterium tuberculosis fbpA/Ag85A Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mycobacterium tuberculosis fbpA/Ag85A Protein, His TagProduct Specification Synonyms Diacylglycerol acyltransferase mycolyltransferase Ag85A, DGAT, Acyl CoA: diacylglycerol acyltransferase, Antigen 85 complex A (85A; Ag85A), Fibronectin binding protein A (Fbps A), mpt44, MT3911 Accession P9WQP2 Amino Acid Sequence Protein sequence (P9WQP2, Phe44 Ala338, with N His Tag)

Product Specification


Synonyms Diacylglycerol acyltransferase/mycolyltransferase Ag85A, DGAT, Acyl-CoA:diacylglycerol acyltransferase, Antigen 85 complex A (85A; Ag85A), Fibronectin-binding protein A (Fbps A), mpt44, MT3911
Accession P9WQP2
Amino Acid Sequence

Protein sequence (P9WQP2, Phe44-Ala338, with N-His Tag) FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFEWYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWLQANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAMGPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWVYCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDSGTHSWEYWGAQLNAMKPDLQRALGATPNTGPAPQGA

Expression System HEK293
Molecular Weight Predicted MW: 33.3 kDa Observed MW: 33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ag85A, a member of the Antigen 85 complex, is a pivotal mycolyltransferase secreted by Mycobacterium tuberculosis and other mycobacteria. This enzyme is essential for constructing the unique, impermeable mycobacterial cell wall. It catalyzes the transfer of mycolic acids—long-chain fatty acids critical for pathogenicity—onto the arabinogalactan layer of the cell envelope, forming a protective lipid barrier. Ag85A also exhibits diacylglycerol acyltransferase activity, contributing to trehalose dimycolate (cord factor) synthesis. As one of the most abundant and immunodominant proteins secreted by the bacillus, Ag85A is a major target of the host immune response and a leading candidate for subunit vaccines against tuberculosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36787889729

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
MJ
San Leandro, US
★★★★★ 4
Solid Upgrade, Needs Color Variety
Replaced my old frother with this one and it's a solid step up. Seriously, better build quality, more features, and noticeably more control. The variable speed dial is genuinely useful. Being able to dial from low (protein powder, matcha) to high (thick cappuccino foam) feels like an actual upgrade. The three whisk attachments give you flexibility depending on what you're making, and the included stand is a nice touch. Helps keeps the coffee bar counter from getting cluttered. Battery life seems strong so far; one charge has lasted through multiple weeks of daily use without issue. Pros: - Variable speed dial works well across a real range (not just "low" and "high") - Three whisk heads included — good for different drink types - Stand included; compact and stays put on the counter Cons: - Singular color option. The mint green clashes with everything on my coffee bar setup; wish there were neutral alternatives. ANY alternatives! - Everyone may not like the price tag but it wasn't out of my budget and the included extra bits made it worth it for me. If your kitchen palette doesn't fight the mint green, this is a capable, well-built frother at a decent price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
R
Verified Purchase
Ryder Mac
Bozeman, US
★★★★★ 5
Mixes matcha well
This is great for mixing matcha due to being able to adjust the speed and make it slower or faster. The stand is a great bonus.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
G
Verified Purchase
gayle johnson
San Leandro, US
★★★★★ 5
Rechargeable hand mixed.
Blends very well and fast. Sound is very quiet. Worth the price. Recommend to friends and family. Recharges fast. Very versitatable i.e eggs, frothing and drink mixes. Good power.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
S
Verified Purchase
Sandra Dutson
Bozeman, US
★★★★★ 5
Worth the money.
It’s very nice. Good quality. Not cheap. Handles well. I’m very satisfied!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
C
Chief
Boise, US
★★★★★ 5
One of the best genral-purpose frothers out there, period
For the longest time, I've been looking for what seems like a unicorn -- something about the size of a mini-frother, but stronger than most. Almost a mini-submersion blender, really. And I still haven't found it. But the Maestri House frothers are about the closest thing I have found, which gives me hope that my unicorn might really exist someday. Unlike cheaper frothers that almost always warn you off from actually washing them, Maestri House makes theirs waterproof. Seriously, you can froth sloppy and get it all up in the whisk end of this, then rinse the whole thing under the faucet if you want to. I really don't recommend that for the speed ring at the top of this one, as a precaution and because it should never be necessary, but you can if you have to. Despite what I believe is cheaping out on the battery at just 1200mAh, it really can last a while, especially if you use it just once or twice a day. That it recharges using a USB-C connector is definitely a bonus. The speed ring at the top is great feature, overall. It turns on at a slow speed and lets you crank it all the way up to a speed that I still haven't found a good use for. This provides a lot of flexibility, from gentle mixing to full-on danger frothing. The included whisks can all be pretty handy. The whisk-whisk is good for things like two or three whole eggs, and the frother-whisk is good for general-purpose frothing. I really haven't figured out what the hook-whisk is for, because this isn't really made for handling any kind of dough, but it might work well for medium-to-thin batters. Generally speaking, I can easily recommend Maestri House frothers over just about any other handheld frother you're going to find. For completeness, though, there are a few things that I think could be improved upon: - The battery. Once you're into the $25+ range, I would expect a a high-current 2000mAh battery, for longevity and torque. - The speed ring is flexible, but depending on your dexterity and grip it can be tricky to operate when dialing in just the right speed, with just one hand. And there's no "Off" button, so you have to wind it down to "Off". For some reason I often end up spinning it the other way and making it go faster instead. Muscle memory should take over eventually, but still. A dedicated On/Off button would be handy. - For as beefy as this device feels, it doesn't handle thick liquids as well as I expected. The torque for basic mixing and frothing tasks is more than enough, but get this into thicker liquids or even four+ eggs, and it starts to bog down. - Like most frothers of this type, the balance of the whisks is a variable thing. If a whisk shaft gets even a little bent this thing will shake, at least when started at slow speed. Things usually settle out at higher speeds, but I'd really like to see the shaft of the whisks made thicker and more rigid so they don't bend so easily. - The frother whisk is good for what it is, and will quickly make great, basic foam. But unless you have supreme technique, it probably won't be good for any kind of latte art. This isn't a big problem in my mind, just something to be aware of. - The stand is okay at best, and unstable at worst. It's just a bit short for some whisks, so some of them can bottom out on the counter and make it unstable. Bending the holder at the top back just a bit with some good pliers, so the whisks are tilted up and away from the bottom, can help. I'll probably end up designing a 3D printed stand to hold this more security, as well as store the extra whisks. - I'm really not a fan of the textured finish on this model. It feels good enough, and the color is okay, but there are obvious seams on each side that, in my opinion, take away from the aesthetic. My call would be that whatever finish might be on the body, it should be seamless around the entire cylinder. I want to be clear, that none of the comments above are intended to warn you off of this if you're looking for a very good, well made frother. I doubt that you can find anything better! I only mention them because nothing is perfect, and to temper the reader's expectations. This brand, if not this specific model of frother, is almost certainly everything that you are looking for. If there's anything you don't like about this particular model on paper, I urge you to consider literally any other handheld frother they make. It only falls short compared to my unicorn device, something I don't ever expect to see from anyone else, but really believe that Maestri House could deliver if they think there's a market.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026

recommand products